Details for Chinese cabbage Locus Brara.E02032

Position : A05 ( 5`- 18602945 .. 18604091 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02032

Protein [Map View]
MYSSSSVSKSVILIHVFAMQLLLINSELPLNTTNAYLNHKCLVSKGKYKPGSEYEKQLKLTIKNFYSDSGNKEGYTMLGS
DGFSAILQCRGDSYGSKCRDCYATAVAALHRRCPWYKAKIIWYDQCLLSFDTKYSTGQIDYDNNFCMSNAKKLGGDKLAF
IRTWNIFMDNLTTLAIRVDNNDPKTSPLYAVGETRFKGDMMYGMVQCTKDIPEKACEECLVFNSIHFQFCLNDKRGARFM
SRSCTFRFEFYPFIAKQVRNI*

DNA
ATGTACTCTTCATCATCTGTATCAAAAAGCGTCATTTTGATCCATGTCTTTGCCATGCAACTTCTCCTTATAAACAGCGA
ATTACCCTTAAACACGACCAATGCGTATCTCAACCACAAATGCTTGGTTAGTAAAGGAAAATACAAGCCGGGAAGTGAGT
ACGAGAAACAGTTAAAATTGACCATCAAAAATTTCTATTCCGACAGTGGCAATAAAGAAGGTTACACCATGTTAGGCTCT
GATGGGTTTTCCGCTATCCTCCAATGCCGCGGCGACTCCTATGGGAGCAAATGCCGCGACTGCTATGCCACCGCCGTTGC
TGCGCTTCATAGGAGATGTCCGTGGTACAAGGCGAAAATAATATGGTATGACCAATGTCTTCTCTCGTTTGATACCAAAT
ATTCTACTGGGCAGATCGATTACGACAATAATTTTTGTATGTCGAACGCTAAGAAGTTGGGAGGAGATAAACTCGCGTTT
ATAAGGACTTGGAATATTTTCATGGACAATCTGACGACTTTAGCCATCCGTGTTGATAATAATGACCCAAAAACATCACC
ATTGTACGCTGTCGGGGAGACGAGGTTCAAGGGTGATATGATGTATGGAATGGTGCAATGTACGAAAGACATACCCGAAA
AAGCTTGTGAAGAGTGTCTGGTGTTTAATAGCATTCATTTTCAATTTTGCTTGAATGATAAACGAGGAGCGAGATTTATG
AGTAGAAGCTGTACTTTTAGGTTTGAGTTTTACCCTTTTATTGCCAAGCAGGTCCGGAATATTTAA