Details for Chinese cabbage Locus Brara.E02025

Position : A05 ( 5`- 18531351 .. 18534466 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02025

Protein [Map View]
MESCSVLEVDINGEETIFLNKQIICKYSGTLKKLLGKSTCSSSGNLKVIFNDFPGGGESFELLSRFCYNNCEWTVMPSNV
VFLHCAAKFMEVTKVLAQTEKCMEEIRYWAWPEVLLSLKQCQELETSSEAESLAVKLMDALVEKLCLAIEASPSSAACSP
SPDSSLFRFSCDSKSTESFKNSSSRITWWFDEVLVLSPGLVKTFLKLMVLRKFDNVTITRFLFYYQKVKFCSASSNEKRE
ILETTVDTLYVLDRSCVPYKSLFGVLRLALGLNINKSVMNKLEVMIGQQLEQATLDNLLVPSPSKSSHLYYVNLVLRFAK
AFLDGGKRGSSQMKKVARLIDQYVAEVAPDPCLKPSKFLSLLTLVPDSARESHEDIYRAIDMYLEAHAGLTNGERLNLIR
ALSYEKLSVQSRAHMSRNTKFQEIETLDDEQQQEQKQLVLRVEKVETSGENEKLKEHIEGIQWRVMELERACLKMQTQME
VIKKRTKSTSRGSNRSLPKLCS*

DNA
ATGGAATCTTGCTCTGTTCTTGAAGTAGACATCAACGGAGAAGAAACTATCTTTCTCAATAAGCAAATCATATGCAAGTA
TTCTGGAACATTGAAGAAACTGCTTGGGAAGTCTACTTGTTCTTCCAGTGGTAATCTCAAGGTGATTTTTAATGACTTCC
CTGGTGGAGGTGAGAGTTTCGAGCTTTTGTCAAGATTCTGCTACAACAACTGTGAATGGACTGTGATGCCTTCGAACGTA
GTCTTCTTGCATTGTGCTGCTAAGTTCATGGAAGTCACTAAAGTCTTGGCACAAACTGAGAAGTGTATGGAGGAGATTCG
GTACTGGGCATGGCCAGAGGTTCTTCTTAGTTTGAAACAGTGCCAAGAACTTGAAACATCCTCTGAGGCTGAGTCTTTAG
CCGTGAAGCTGATGGATGCGCTGGTGGAGAAACTGTGTTTAGCCATTGAAGCGAGTCCCTCTAGCGCTGCTTGCTCGCCT
TCGCCGGATAGCAGCTTGTTTAGGTTCTCTTGTGACAGTAAAAGCACAGAGAGTTTCAAGAACAGCTCTTCCAGGATAAC
ATGGTGGTTCGATGAGGTTCTTGTTCTAAGTCCTGGCTTGGTTAAAACGTTCTTGAAGCTGATGGTGTTGAGGAAGTTCG
ATAATGTTACCATCACTAGGTTCTTGTTCTATTACCAGAAGGTTAAGTTCTGTTCTGCGTCATCAAATGAGAAAAGAGAG
ATTCTGGAAACGACCGTTGATACTCTCTACGTGTTGGACCGAAGCTGTGTTCCTTACAAGAGTCTTTTCGGTGTTTTGAG
GCTGGCTCTTGGGTTAAACATAAACAAAAGTGTTATGAACAAGCTGGAGGTTATGATTGGTCAGCAACTGGAACAAGCAA
CACTCGACAACCTCCTTGTTCCATCTCCATCGAAGTCTAGTCACTTGTACTATGTGAATCTTGTTCTTAGATTCGCAAAA
GCTTTCCTTGACGGAGGGAAAAGAGGATCATCACAGATGAAGAAAGTGGCGAGGTTGATTGATCAGTACGTAGCTGAAGT
AGCACCTGATCCTTGCTTGAAGCCTTCAAAGTTTCTGTCACTCCTCACACTCGTTCCTGACTCAGCAAGAGAGTCTCATG
AAGATATCTACCGTGCTATTGACATGTATCTTGAGGCACATGCAGGATTAACCAATGGTGAAAGACTCAACTTGATAAGA
GCTTTGAGTTACGAGAAGCTTTCAGTCCAATCAAGAGCACATATGTCGCGTAACACAAAGTTTCAGGAGATTGAGACATT
AGATGATGAGCAGCAACAAGAACAGAAGCAGCTCGTACTCAGAGTGGAGAAGGTAGAGACTTCAGGAGAGAATGAGAAGT
TGAAAGAGCATATAGAAGGGATTCAGTGGAGGGTGATGGAGTTGGAGAGAGCGTGTTTGAAAATGCAGACTCAGATGGAA
GTTATCAAGAAGAGAACCAAGAGCACTAGCAGAGGAAGCAACAGATCTCTTCCTAAGCTCTGTTCTTGA