Details for Chinese cabbage Locus Brara.E02007

Position : A05 ( 5`- 18296518 .. 18299367 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02007

Protein [Map View]
MGKRDEKAEAVLRLLRKQTPLTLKQEKFCNRDCVERFLKGKGDNVKKAAKQLTSCLSWRQNFDIERIGAEEFSAELADGV
AYIAGHDGESRPVIMFRFKHDYQKLRSQKQFTRLVAFTMETAISSMSRNAEQSVVLLFDASFFRSSSAFANLLLATLKMI
ADNYPCRLHKAFIIDPPSFFSYIWKGVRPFVELSTVTMLISSLDYDEQLDISHVSSSSCLRSASLRFDPSSIKSTAKIGS
ASSRFAFTVSHNSMKPWYLSLTDTSPFHAAVDSTASKVSPLSVRSLSFASPAGRGLRDPKPAACRKSLFPSTPLPEKTKT
VPHRKTPRPSFFQSPAMFFRGEKNVGGGEKSSREAFVPYLKFYRRPYDETAYRSKLRGPRGFVSVVSSHRRCRHVSLSQR
F*

DNA
ATGGGCAAGAGAGATGAGAAAGCCGAAGCTGTTCTTCGTTTACTCAGGAAACAAACTCCACTCACTCTTAAACAAGAGAA
GTTCTGTAACAGAGACTGCGTGGAGAGGTTCTTGAAAGGAAAAGGAGATAACGTCAAAAAAGCTGCGAAGCAGCTAACTT
CATGCCTTTCGTGGAGACAAAACTTTGATATTGAGCGAATAGGGGCAGAGGAGTTCTCGGCGGAGCTAGCCGACGGCGTA
GCTTACATCGCCGGCCACGACGGAGAATCCAGACCCGTTATCATGTTCCGTTTCAAGCATGATTATCAGAAGCTGCGTAG
CCAGAAACAATTTACGCGTTTAGTGGCGTTCACGATGGAGACTGCGATCTCGAGCATGTCCAGAAACGCGGAACAGAGCG
TTGTTCTACTCTTCGATGCAAGCTTTTTCAGATCATCCTCTGCTTTTGCAAATCTGCTTTTGGCAACCCTAAAAATGATC
GCAGATAATTACCCATGCCGACTTCACAAGGCCTTTATCATTGACCCTCCCTCCTTTTTCTCTTACATTTGGAAGGGTGT
ACGTCCTTTCGTGGAGCTATCTACTGTCACTATGTTAATCTCGTCTCTAGACTACGACGAGCAGCTAGATATTAGCCACG
TGTCATCATCGTCATGTCTTAGATCAGCTTCCCTACGTTTCGATCCATCGTCGATTAAATCAACGGCTAAGATTGGTTCA
GCTTCTTCAAGATTCGCCTTCACCGTATCTCACAACTCAATGAAGCCGTGGTACCTTTCCTTAACCGACACATCACCGTT
TCACGCCGCCGTCGACTCCACCGCTTCCAAAGTATCTCCTCTCAGCGTGCGTTCTCTATCTTTCGCGTCTCCGGCGGGGC
GTGGTTTAAGAGACCCGAAACCAGCCGCATGCAGAAAGAGTTTGTTTCCCTCGACGCCGTTGCCGGAGAAGACGAAAACG
GTTCCGCACCGAAAAACTCCACGTCCGTCTTTTTTTCAGTCTCCGGCGATGTTCTTTCGCGGGGAGAAAAATGTCGGCGG
AGGCGAGAAGTCATCACGTGAAGCGTTCGTACCGTATCTGAAGTTTTATCGGAGACCGTACGATGAGACGGCCTATAGGT
CTAAACTGCGGGGTCCACGTGGATTTGTGTCAGTCGTGTCTTCGCACAGAAGATGTCGCCACGTATCTTTATCTCAACGG
TTCTAG