Details for Chinese cabbage Locus Brara.E02003

Position : A05 ( 5`- 18239202 .. 18243266 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02003

Protein [Map View]
MVGGNNDKSTPQKPPTTSAAASSSHHRKSRWGSNNNDGGSSKTNTTTTNNNKQTTGGQKIADKKPSSNLAPIPSQSRPNH
PNPTPSSSSSRSALPAAQFAFPDPSAALGAPPAPTYGFHMLERRTIVLNDGSVRSYFALPPNYRDFPPKPRLPDPAANRF
MGGRFPPEEFRDQMQFYDRPEGGSLKRKHPGEEEIDRGELLRQRQQFMQYANPDDPSLMAGTSRRDAGEDARAAKHMRVG
SSRNENGGQVALKKAFLDLVKRIYEDPVEKKNYLENGRKGRLQCLVCGRCPKDVQDTHGLVMHTYYCDDTSSRVHHLGLH
KALCVLMGWNFSKPPDNSKAYQNLPAEMVAINQDELILWPPHIIVHNTSTGKGKDGRMEGLGSKRMDDRIRELKFNVGKS
RALYGRDGHLGITLFKFAGDDSGLREALRIAEYFEKMNRGRKSWAGLQPFTPSKDDENNPSLMEVDGKTGEKRRVLYGYL
ATVKDLDKVDMETKKKTTIESLRELAGSK*

DNA
ATGGTCGGAGGCAATAACGACAAGTCAACGCCTCAAAAGCCTCCAACAACCTCCGCCGCAGCTTCTTCTTCCCATCACCG
TAAATCTCGTTGGGGCTCAAACAACAACGATGGTGGTAGCAGTAAGACTAACACAACCACCACCAACAACAACAAGCAGA
CGACGGGTGGCCAGAAAATCGCCGATAAGAAACCTTCTTCTAACCTAGCTCCGATCCCGAGCCAATCCCGTCCTAACCAC
CCCAATCCAACACCCTCTTCATCATCATCGCGTTCTGCTCTACCCGCGGCGCAATTCGCTTTCCCAGATCCGTCGGCGGC
GCTTGGTGCTCCTCCTGCGCCGACTTACGGGTTCCATATGCTCGAGCGTCGCACCATCGTCCTCAATGACGGAAGCGTCC
GATCATACTTCGCCCTTCCTCCTAATTACCGTGATTTCCCTCCCAAGCCCCGTCTCCCTGATCCGGCGGCTAATAGATTT
ATGGGCGGTAGATTCCCTCCGGAGGAGTTTAGAGATCAGATGCAGTTTTATGATCGCCCCGAAGGAGGGTCGCTGAAACG
GAAACATCCAGGCGAGGAAGAGATTGATAGAGGTGAATTGCTGAGACAAAGGCAGCAGTTTATGCAGTATGCGAATCCTG
ATGATCCCTCGCTTATGGCTGGTACCAGTAGGAGGGATGCTGGGGAAGATGCTAGAGCCGCTAAGCACATGCGGGTAGGA
TCAAGCAGGAATGAGAATGGAGGTCAGGTTGCGTTAAAGAAAGCGTTTTTGGATTTGGTTAAGCGGATTTATGAGGACCC
GGTGGAGAAGAAGAACTACTTGGAGAACGGGAGGAAAGGGCGGCTTCAGTGTCTCGTCTGCGGCAGGTGTCCTAAAGACG
TCCAGGATACACATGGTTTGGTAATGCACACGTACTATTGCGATGATACTAGCTCACGTGTGCATCACTTAGGCCTACAC
AAAGCTCTATGTGTATTGATGGGATGGAATTTCTCAAAGCCCCCTGATAACTCGAAGGCTTACCAGAATCTACCTGCGGA
AATGGTAGCAATCAATCAAGACGAGCTGATTCTATGGCCACCTCACATTATTGTTCACAATACGAGTACAGGGAAGGGTA
AAGATGGGCGAATGGAAGGTCTTGGAAGCAAAAGAATGGATGACAGAATTAGAGAACTAAAATTCAACGTTGGGAAATCA
AGGGCACTGTATGGAAGAGACGGTCATCTAGGAATTACCCTCTTTAAATTTGCGGGAGATGATTCAGGGCTCAGGGAAGC
TTTGAGAATTGCCGAATACTTTGAGAAAATGAACCGTGGGCGCAAAAGTTGGGCCGGGTTACAACCATTCACTCCAAGCA
AAGATGATGAGAACAACCCTAGTCTTATGGAGGTTGATGGTAAGACAGGTGAGAAAAGGAGGGTCCTTTATGGGTATCTG
GCGACCGTAAAAGACTTGGACAAAGTCGATATGGAGACAAAGAAGAAGACCACAATTGAGAGCCTAAGAGAACTCGCAGG
GTCAAAGTGA