Details for Chinese cabbage Locus Brara.E01999

Position : A05 ( 5`- 18217796 .. 18218748 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01999

Protein [Map View]
MSQQEQPRRPQEPVKYGDVFEVSGELADKTVAPEDANMMQAAETRVFGHTQKGGTAAVMQSAATANKRGGFVQQGDATDV
AAEHGVTVAQTDVPGARVTTEFVGGQVVGQYVEPMPVGTTAATDAETLGLNLQSAITIGEALEAAVQTAGNKPVDQSDAA
AIQAAEVRASGTSVIAPGGIAASAQSAANHNATVDRDEEKIKLVDVLAGATGKLQADKAVTRQDAEGVVSAELRNNPNLT
THPGGVAASVTAAARLNEKADI*

DNA
ATGAGCCAGCAAGAGCAACCACGTAGGCCACAAGAGCCGGTGAAATATGGCGACGTTTTCGAAGTCTCCGGGGAACTAGC
AGATAAGACCGTAGCGCCTGAGGATGCAAACATGATGCAAGCAGCCGAGACGCGCGTCTTCGGACACACTCAAAAAGGCG
GTACAGCCGCCGTCATGCAGTCTGCAGCCACTGCCAACAAACGTGGTGGCTTCGTCCAACAAGGTGACGCAACCGACGTC
GCGGCTGAACATGGCGTCACCGTGGCGCAAACAGACGTCCCTGGTGCACGTGTCACTACAGAATTCGTCGGTGGACAGGT
CGTTGGACAATACGTGGAGCCGATGCCTGTGGGGACTACTGCGGCTACAGACGCTGAAACGTTGGGATTGAATTTGCAAA
GTGCGATAACAATAGGAGAAGCATTGGAGGCAGCTGTACAAACCGCTGGAAACAAACCGGTGGACCAGAGCGATGCAGCA
GCGATCCAAGCGGCGGAGGTCAGAGCTTCTGGAACCAGCGTCATTGCTCCCGGTGGAATCGCCGCTTCAGCTCAATCCGC
AGCGAATCACAACGCTACTGTGGACCGTGACGAGGAGAAAATCAAGCTCGTTGATGTTTTGGCGGGTGCTACGGGGAAGC
TACAGGCGGATAAAGCCGTGACGAGGCAGGATGCAGAGGGTGTGGTGAGCGCTGAGCTGAGGAACAACCCTAACTTGACT
ACTCATCCAGGTGGTGTGGCAGCTTCTGTCACCGCTGCGGCTAGGCTTAACGAGAAGGCGGATATATGA