Details for Chinese cabbage Locus Brara.E01996

Position : A05 ( 5`- 18205922 .. 18208868 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01996

Protein [Map View]
MSAPFYSSIDIHQQQIGQTPPGFDTEPVPISTYQDTEPVPLSTYREAEPDPFHATQQEKDDFWDNGFNREEPEHFQPKEN
GKRSVDHNSSFTHGETDLNQLPAIPQFSTGQGLPYAPVDWPSPGDVWTWRVGRRVTATGFHQDRFLILPQRLQQKNVPKS
FASKPTLSRYIQTSFPGMDANAFFASFSWKIPALFQPANKVDAASLFEETPNEVQTESALNDENAKEGNSRYSQRKRNPM
PTYDLVEETKPKANKKKKGATTPATGTQSSTKPKPSRQSERRSANHQNGGAVDLNHLNEEGEPNTSGSRRKKRRANVEEE
EDVSIPHIYVSPMNGVLAVSHEPIDVDPVEFDSYLNSLENLLHESQKDAARESSSSVLVTSSSPMREYEWAEVRMKISSL
LEKDLPTLFISKDAAEIAALATKLRKDPNLSAEEIVRLKLIEEISKFSEVFQENKSVIEEADGFFSALELNKAKVASLKY
EYSDLRHKLGSIQMEVDENSEAIRQIDDKISQLQARRNELKRYTGSKEREKVDLSYGQKMVANSIPKVVQEVQSANSKKH
EWECKKDNALKREEEILSKFIPLKGFFL*

DNA
ATGTCTGCTCCGTTTTATTCTTCGATTGATATTCATCAACAACAGATCGGTCAAACTCCTCCTGGGTTTGATACTGAACC
AGTCCCAATCAGTACCTATCAAGACACTGAACCTGTCCCACTCTCAACCTACCGAGAAGCCGAACCTGATCCATTTCACG
CCACTCAGCAAGAGAAGGACGACTTCTGGGATAACGGTTTCAACAGAGAAGAGCCAGAGCACTTTCAGCCCAAGGAAAAT
GGAAAGAGAAGCGTAGACCACAACAGCTCCTTCACTCATGGGGAAACCGATCTCAACCAACTTCCAGCTATCCCGCAGTT
TTCAACTGGTCAAGGTCTGCCTTACGCCCCTGTTGATTGGCCAAGCCCTGGCGATGTTTGGACTTGGAGAGTCGGTAGGA
GAGTGACTGCTACTGGGTTTCATCAAGACAGGTTCTTGATTCTCCCTCAAAGGCTTCAACAGAAGAATGTGCCAAAGTCT
TTCGCAAGCAAACCCACTCTCTCTCGTTACATCCAAACGAGTTTCCCTGGCATGGATGCTAATGCTTTCTTCGCGTCGTT
TAGCTGGAAGATCCCTGCTCTCTTCCAGCCTGCCAACAAAGTTGATGCTGCGTCTCTTTTCGAGGAGACACCGAACGAAG
TACAGACTGAATCTGCCCTTAATGATGAGAATGCTAAAGAAGGAAACTCCAGGTACAGCCAGAGGAAGAGGAATCCAATG
CCTACGTATGACCTTGTGGAAGAAACTAAACCTAAAGCAAACAAGAAGAAGAAAGGAGCCACAACTCCTGCCACTGGAAC
TCAATCCTCCACCAAACCAAAACCATCTCGTCAATCCGAAAGACGCTCTGCAAACCACCAGAACGGTGGCGCTGTGGACT
TAAACCACCTCAACGAGGAAGGTGAACCAAACACTAGTGGCAGTAGGAGAAAGAAACGCAGAGCTAACGTTGAGGAAGAA
GAAGATGTTTCCATCCCTCACATCTACGTCTCTCCTATGAACGGTGTCCTCGCTGTCTCACACGAGCCTATCGATGTTGA
CCCTGTAGAGTTCGACAGCTACCTAAACTCTCTTGAGAACCTTCTTCATGAGAGTCAAAAAGATGCTGCGAGAGAGTCTT
CTTCCTCTGTTCTCGTCACTTCAAGCTCTCCAATGAGAGAGTACGAATGGGCTGAAGTTAGAATGAAGATCTCATCTCTC
CTTGAGAAAGACCTCCCCACTTTGTTCATCTCCAAGGACGCTGCGGAGATAGCAGCGTTAGCAACTAAGCTGAGAAAAGA
TCCAAACCTTTCCGCCGAAGAGATAGTGAGGTTGAAGCTTATAGAAGAGATTTCAAAGTTCAGTGAAGTCTTCCAGGAGA
ACAAGAGTGTGATTGAAGAAGCAGACGGTTTCTTCTCTGCGCTTGAGCTTAACAAAGCTAAAGTAGCGTCACTTAAATAC
GAGTACAGCGATCTGAGGCACAAGCTAGGGAGCATACAGATGGAAGTAGATGAGAACTCTGAGGCGATTCGCCAGATTGA
TGACAAGATCTCACAGCTTCAAGCTAGGAGGAATGAGCTGAAGCGGTACACAGGGAGCAAGGAGAGGGAGAAGGTTGATC
TTAGCTATGGGCAGAAGATGGTGGCGAACTCGATACCTAAAGTGGTGCAGGAAGTTCAGTCAGCTAACTCGAAGAAGCAT
GAATGGGAATGTAAGAAGGATAATGCACTTAAGCGTGAAGAAGAGATCCTCTCTAAGTTCATTCCTCTTAAAGGCTTCTT
CCTCTGA