Details for Chinese cabbage Locus Brara.E01995

Position : A05 ( 5`- 18204530 .. 18205817 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01995

Protein [Map View]
MVLIPWNRSFPSLILSLLIILTIEKPDPEAMRVHPIPRNLNNNTLIHHHHHRRNPTREPGKNLRRLPHIFSRVLELPLRS
EADVAVEEKHDCFRFVAETEGLCDGGEMRAYVVDIHPGITKIVVRTNGLSLGLSLDELELDMWRFRLPETTRPELVTVVC
VDGVLIVTVPKMLPEEEEDGGFRQGMASGRLVLVQ*

DNA
ATGGTTTTGATTCCTTGGAATCGATCATTCCCGAGTCTGATCCTCTCGCTTCTCATCATTCTAACAATCGAGAAACCCGA
CCCGGAAGCCATGAGAGTCCACCCAATCCCCAGAAACCTTAACAACAACACCTTGATCCACCACCACCACCATCGTCGTA
ACCCGACCCGAGAACCCGGAAAGAATCTGCGTCGTTTACCGCACATCTTCAGCCGCGTTCTTGAGCTTCCGTTAAGGTCC
GAAGCAGATGTTGCCGTGGAGGAGAAACACGATTGTTTCAGATTCGTGGCGGAGACGGAGGGTCTCTGCGACGGCGGGGA
GATGAGGGCCTACGTGGTGGATATCCATCCGGGTATAACCAAGATCGTTGTGAGGACAAATGGGTTGTCTTTGGGGTTGT
CGTTGGACGAGTTGGAGCTCGACATGTGGCGTTTCAGGCTTCCGGAGACGACCAGGCCTGAGCTTGTTACGGTGGTTTGT
GTTGATGGGGTTTTGATTGTTACCGTGCCCAAGATGCTTCCAGAGGAGGAGGAAGATGGTGGTTTTCGACAAGGTATGGC
AAGTGGGAGGCTTGTTCTTGTTCAGTAA