Details for Chinese cabbage Locus Brara.E01987

Position : A05 ( 5`- 18123419 .. 18124679 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01987

Protein [Map View]
MKMGMGLVVLTVFMAVMSSTRVLAQSTCTSALISMSPCLNYITGNTTSPSQQCCSQLGNVVRSSPDCLCQVLNGGGSQLG
INVNQTQALALPRACNVQTPPVSRCNNGGGSTADSPADSPNSSGPGNGSKTVPVGEGEGEGPSSDGSSIKFSYPLLAFLS
VASYMAIFLKY*

DNA
ATGAAAATGGGAATGGGTTTAGTGGTGCTTACAGTTTTTATGGCTGTGATGTCTTCTACAAGAGTCCTTGCTCAGTCGAC
TTGCACATCCGCTTTGATCAGCATGTCTCCGTGTCTCAATTACATAACAGGAAACACAACCTCTCCGTCTCAGCAATGCT
GCAGTCAGCTGGGTAACGTTGTCAGGTCTTCTCCTGATTGTTTGTGTCAAGTCCTCAACGGTGGTGGCTCTCAGCTCGGG
ATCAACGTTAACCAAACACAGGCTCTTGCTTTGCCTAGAGCTTGTAATGTTCAGACTCCTCCTGTCAGTCGCTGTAACAA
CGGTGGTGGTTCTACTGCTGACTCTCCTGCAGACTCACCAAACTCTTCAGGACCAGGAAATGGATCGAAAACTGTACCTG
TAGGAGAAGGAGAAGGGGAAGGACCATCGTCAGACGGAAGCTCTATCAAGTTCTCATATCCTCTTCTTGCCTTCCTTTCC
GTTGCTTCCTACATGGCAATCTTCTTGAAATACTGA