Details for Chinese cabbage Locus Brara.E01983

Position : A05 ( 5`- 18081232 .. 18082432 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01983

Protein [Map View]
IQLEKHLSRVWSRNIEKNPKPKEEWEIELAKLEMSNVIARGAYGIVYKGIYDGQDVAVKVLDWGEDGYATTAETSALRAS
FRQEVGVWHKLNHPNVTKFVGASMGTTNLKIPSSAEMENSLPQRACCVVVEYLPGGTLKQYLFRNRRRKLAIRVVVQLAL
DLSRGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFG
ICLWEIYCCAMPYPDLSFADVSSAVVRQ

DNA
ATTCAGCTGGAGAAACATCTGAGTAGGGTTTGGTCAAGAAACATCGAGAAGAATCCAAAGCCTAAGGAAGAGTGGGAAAT
CGAGTTGGCTAAATTGGAGATGAGCAATGTCATTGCTCGTGGTGCTTATGGTATTGTCTACAAAGGCATCTATGATGGTC
AAGACGTTGCAGTGAAAGTGCTTGATTGGGGAGAAGATGGTTACGCGACAACGGCTGAGACTTCAGCTCTTCGTGCTTCG
TTCCGACAAGAAGTTGGGGTTTGGCACAAACTTAACCATCCCAATGTCACAAAGTTTGTTGGAGCATCAATGGGGACAAC
AAATCTAAAGATACCTTCATCAGCTGAGATGGAGAACTCGTTGCCTCAGAGAGCTTGTTGTGTGGTTGTGGAGTATCTTC
CTGGAGGAACTCTTAAGCAATATTTGTTCCGTAACAGGCGAAGGAAACTCGCTATTAGAGTTGTGGTTCAACTCGCTCTA
GATCTCTCCCGAGGGCTAAGTTATTTGCATTCAGAGAGAATCGTTCATCGGGACGTGAAAACAGAGAACATGCTATTGGA
TTATCAGAGGAATCTAAAGATTGCTGATTTTGGAGTGGCTAGAGTTGAAGCTCAGAATCCAAAGGACATGACTGGAGAAA
CTGGTACTCTTGGATACATGGCTCCAGAGGTTCTTGATGGTAAGCCATACAACAGAAGATGCGATGTTTACAGTTTCGGG
ATATGCTTGTGGGAGATTTATTGTTGTGCTATGCCTTATCCTGATCTCAGCTTTGCTGATGTTTCTTCTGCTGTTGTTCG
TCAG