Details for Chinese cabbage Locus Brara.E01980

Position : A05 ( 5`- 18032426 .. 18038897 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01980

Protein [Map View]
MATVLHSESRRLYSWWWDSHIPKNSKWIQQNLADMDSKVKAMIKLIEEDADSFARRAEMYYKKRPELMKLVEEFYRAYRA
LAERYDHATVELRHAHKTMAEAFPNQVPFDMIEDSASSSCSEPRTPDKMPPGIQPFYDSDGTTSRRGLSQLSECVGSSET
EVESLKRALVELGAEKEALNLQYQLSLNKLSKLEEDLKDAQKDVNGLGERASKAEIESKILAEGLAKLEAERDAALLRYN
QAMEKIADLDESFALAQEDIKRLTNRAIKAETEAESLKEEQSRLHSEKEAGLAQYKQCLEMISTLEKKVKEAEENAQLFS
NQSAKAEDEIKALRHELLKVNEVKDGLIIRYKQCLETISKLEREVSHAQENAKRLSSEVLAGAAKLKTVEEQCTVLECSN
ETLKVEADGLTHRLAAKDQELIQKQNELEKFQGLIQDEQSRFLEIEASLRSLKALHSQSQEEQKVLASELQSRVEMLREL
ETRNHSLEGEIISVKEENRNISDSSMISLETQKCEISSLKEVKGRLEEEVARHINQSSALQEEICRLKDEINSLNRRHQA
IMEQVKFAGLEPESLACSVRKLQDENSKLTELFNLQRDDTDALTEKLCEMDDILRKSVGLEKLLLESNTKLDGSREKVKD
LQERCDSLRIEKSEFIAERSNLLSQLQIMTENMQKLLEKNSLLETSLSGANIELQGVKEKSKCFEEFFELLKNDKAELTK
ERESLISQLNSVKEKLGFLEKDFTELQGRYADLQRDKQFKNLQVEELRVSLATEKQERASYERSTDTRLADLQSNVSFLR
EECRSRQKEFEEELDRAVNAQVEIFILQKFIEDLEQKNFSLVIECQKYAEASTFSEKLITELESENLEQQMETEFLLHEI
DNCRGAIYQVFKALQLEADCAKERVPVSRILGGINELKRSLSISEYEKQRLVIENSVLLSLLGQFQSDCMKVESEKENAE
KDLETMVHRYGMLKKDRLELLELNRQLKAELMDREQRELELRAELQTEHSKFESLHESYMALHQDYSNALCKNKTLDLKF
SELKGEMRTLEEENDAILQEAVSLSNMSVVYQSFWSEKAEAFAEDLRSLQNINRGLKQKVETLEEKLKGKEVDSQDLNSK
LEKLQESLEEANELTDLLEHQITDKEETMRQKAIELLEAEEMLKATHNANAELCEAVEELRKDCKESKQLRRNLERRISE
LVECSGRQDEEIKKLSNVKENLEVEVELLHKEIQEQRVREEFLSSELQEKSNEFGLWDAEATSFYFDLQISAVREVLLEN
KVKELTGVCENLKDEAVSKTSEIKQMKETVGFLEYEVTVLKTQLSAYDPVVASLAEDVKSLEKNALLLMKLPAPSDRCRE
DDEDSEAEVSQGHSSTNQDNGIVLLQDMRTRVKIIEQAVVGEKKRLGKQRRRSSSHRSRDRRLLEETEHEDKFSGEFRQP
RSPAITEMRNGSLMKDIPLDHVADSPFYGRSRRTSRGSNDQMLELWEESAEPESSIKSLMNSKKPTLPRLHRRSRNPSIE
SQSEKVVDKLELSKSAEENAKIMERLLADSRRLASLRVILRDLKSKLDLSEKPGKFTNPEFARVRKQLKEIEDAILQLEN
TNEILAKEIEETGDARDIYRKVVIEKSRIGSEKIELMEQEMHNIERTVLKLEDGAAKSKGKTKFSESRTVILLRDIIHKG
GKRTARKKKNRFCGCMRSSSAKEE*

DNA
ATGGCTACCGTGCTGCATTCCGAGTCGAGGCGCTTGTACTCCTGGTGGTGGGATAGTCACATCCCCAAAAACTCTAAATG
GATCCAACAGAATCTTGCAGATATGGATTCCAAAGTCAAGGCCATGATCAAACTCATCGAAGAGGATGCAGATTCTTTTG
CGAGAAGGGCTGAGATGTACTACAAGAAACGTCCAGAACTGATGAAACTTGTTGAAGAATTCTACAGAGCTTACCGTGCA
CTAGCAGAGAGGTACGATCATGCGACCGTGGAGCTTCGTCACGCTCACAAAACCATGGCCGAGGCGTTCCCTAACCAAGT
GCCCTTCGACATGATTGAGGATTCTGCTTCTTCCTCTTGCTCTGAGCCACGCACGCCTGATAAAATGCCACCTGGAATCC
AGCCCTTTTATGACTCTGACGGTACCACGAGTAGAAGAGGGTTAAGTCAGCTGAGTGAGTGCGTGGGAAGTTCTGAAACA
GAAGTTGAGAGTTTGAAGAGAGCTTTGGTTGAGCTTGGGGCTGAGAAGGAAGCCTTGAATCTTCAGTATCAGCTGAGCCT
GAACAAATTATCAAAACTAGAAGAAGACCTTAAAGACGCTCAAAAGGATGTTAATGGGCTTGGTGAACGTGCTAGCAAAG
CTGAGATTGAGAGTAAGATACTTGCAGAAGGCCTTGCGAAGCTTGAAGCCGAGAGGGATGCTGCGCTTCTTCGATATAAT
CAAGCTATGGAGAAGATAGCAGATCTGGATGAATCATTTGCTCTTGCGCAAGAAGATATAAAGAGGCTCACCAACCGAGC
GATTAAAGCAGAGACAGAAGCAGAGAGTCTCAAGGAAGAGCAAAGTAGATTGCACTCTGAGAAGGAAGCTGGCTTAGCGC
AGTACAAGCAATGCCTTGAGATGATATCTACTCTAGAGAAGAAGGTGAAAGAGGCCGAGGAGAATGCTCAACTGTTTAGC
AATCAGTCTGCAAAAGCAGAAGATGAGATTAAAGCACTGAGACATGAGCTTCTGAAGGTGAACGAAGTGAAGGACGGTTT
GATTATTCGCTACAAGCAGTGTTTGGAAACGATATCCAAGCTAGAAAGAGAAGTCTCTCATGCTCAAGAAAATGCCAAAA
GACTGAGTAGTGAAGTTCTGGCTGGAGCTGCAAAATTGAAGACTGTTGAGGAGCAATGTACTGTTTTGGAGTGCTCAAAT
GAAACTTTGAAGGTAGAAGCAGATGGTCTAACACACAGATTAGCAGCTAAGGATCAAGAACTTATCCAGAAGCAAAACGA
GCTTGAAAAGTTTCAAGGTTTGATCCAAGATGAGCAGTCTCGGTTTTTGGAAATCGAAGCCAGTCTTAGAAGTTTGAAAG
CTTTGCATTCTCAGTCCCAAGAGGAGCAGAAGGTTCTTGCTTCAGAACTTCAAAGCAGGGTTGAGATGCTGAGGGAGTTA
GAGACTCGTAATCATAGCTTGGAAGGCGAGATCATCTCAGTCAAAGAAGAAAATCGAAACATAAGTGACTCTTCTATGAT
CTCCCTTGAGACTCAGAAATGCGAGATTTCTAGCTTGAAGGAAGTTAAAGGAAGACTCGAGGAAGAAGTAGCTAGACACA
TTAACCAAAGCAGTGCCCTCCAAGAAGAGATCTGTCGTCTGAAGGACGAAATCAACAGCTTGAATAGAAGGCATCAAGCA
ATAATGGAGCAAGTGAAATTCGCTGGATTGGAACCTGAATCCCTTGCCTGCTCTGTGAGGAAGCTACAAGACGAAAACTC
AAAACTGACTGAGTTGTTTAACCTCCAAAGAGATGATACAGATGCTCTTACCGAAAAGCTGTGTGAGATGGATGACATTC
TAAGGAAGAGTGTTGGTCTAGAGAAACTGCTTCTGGAATCAAACACTAAACTAGATGGTTCTAGGGAGAAGGTAAAGGAT
CTGCAAGAAAGATGCGACTCTCTACGAATAGAGAAATCTGAGTTTATCGCCGAGAGATCTAACTTGCTTTCTCAGTTGCA
AATCATGACTGAGAATATGCAGAAGCTCTTGGAAAAGAACTCGTTATTGGAGACATCCCTCTCTGGTGCAAACATTGAGC
TTCAAGGTGTAAAGGAGAAGTCAAAATGCTTTGAAGAATTCTTCGAGCTGCTCAAAAACGATAAGGCCGAGCTCACAAAG
GAAAGAGAATCTCTCATCTCTCAGTTAAACAGTGTTAAGGAGAAGCTAGGATTTTTGGAGAAGGACTTCACTGAACTGCA
AGGAAGATATGCTGATCTACAGAGGGACAAACAGTTCAAAAATCTTCAAGTGGAAGAGCTAAGAGTCTCGCTAGCCACAG
AGAAGCAAGAGCGTGCGAGTTACGAAAGATCAACTGACACCAGATTGGCAGATCTGCAGAGTAACGTGAGCTTTCTTCGA
GAAGAGTGTCGCTCCAGGCAAAAAGAGTTTGAAGAAGAGCTTGATAGAGCTGTAAATGCTCAAGTGGAGATCTTCATCTT
GCAGAAGTTTATAGAAGACTTGGAGCAGAAGAACTTTTCTCTCGTGATTGAGTGCCAGAAGTATGCGGAGGCGTCAACGT
TCTCAGAGAAGCTCATTACTGAGCTTGAAAGCGAGAATCTTGAGCAACAGATGGAAACAGAGTTCTTGCTGCATGAGATT
GATAACTGCAGAGGTGCAATCTATCAAGTCTTCAAGGCACTCCAACTTGAAGCAGATTGTGCAAAAGAGAGAGTTCCAGT
TTCACGCATCTTGGGTGGAATTAATGAACTGAAACGTTCACTTTCCATCTCTGAATATGAGAAGCAGCGGCTTGTGATTG
AGAACTCTGTTCTTTTATCTCTACTTGGACAGTTCCAATCCGATTGCATGAAGGTGGAATCAGAGAAAGAGAATGCAGAG
AAAGATCTGGAGACGATGGTACATCGCTACGGAATGCTGAAAAAGGACAGGCTCGAGCTGTTGGAATTGAACCGCCAGTT
GAAAGCAGAACTGATGGACAGAGAGCAGCGGGAGCTGGAGCTAAGAGCTGAACTGCAAACGGAGCATTCAAAGTTTGAGA
GTTTGCATGAGTCATACATGGCTTTGCATCAAGATTACTCAAATGCTCTATGCAAAAACAAAACTTTGGATCTGAAATTC
TCAGAGCTTAAAGGTGAAATGCGTACACTTGAGGAAGAGAACGATGCCATTCTTCAAGAAGCTGTTTCCTTGAGCAACAT
GTCTGTGGTTTACCAGTCATTTTGGTCTGAAAAGGCTGAAGCGTTTGCTGAAGACCTGAGAAGTTTACAAAATATTAATA
GGGGGCTGAAGCAGAAGGTTGAGACATTGGAGGAGAAGTTAAAAGGAAAAGAGGTGGACAGTCAGGACCTTAATAGCAAG
CTGGAGAAGTTACAGGAAAGCCTCGAAGAAGCCAACGAGCTAACTGATCTCTTAGAACATCAGATTACAGATAAAGAGGA
AACCATGAGACAGAAGGCGATAGAGCTTCTGGAAGCCGAAGAGATGCTCAAGGCTACACACAATGCAAATGCGGAACTGT
GCGAGGCAGTTGAAGAGCTGAGGAAAGACTGTAAGGAATCAAAACAACTAAGGAGAAATTTGGAGAGGCGGATCTCTGAA
CTGGTTGAATGCAGTGGGAGACAGGATGAAGAGATTAAAAAGCTTAGCAATGTGAAGGAGAATCTGGAGGTTGAGGTAGA
GTTGCTACACAAGGAGATCCAAGAACAGCGAGTTCGAGAGGAGTTCCTGAGTTCGGAGCTGCAGGAGAAAAGCAATGAGT
TCGGACTTTGGGATGCGGAGGCAACATCTTTCTACTTTGATCTACAGATCTCAGCTGTCCGTGAAGTTTTGCTGGAGAAC
AAAGTTAAGGAACTCACTGGAGTTTGTGAAAACCTCAAAGATGAAGCTGTTTCAAAGACCTCAGAGATAAAGCAGATGAA
AGAAACAGTTGGATTCTTAGAATATGAAGTGACTGTGCTGAAGACTCAACTGTCTGCCTATGATCCAGTGGTAGCATCTC
TTGCAGAAGATGTTAAATCACTAGAGAAAAATGCACTGTTGTTGATGAAACTCCCTGCGCCATCTGATCGTTGCAGAGAG
GATGATGAGGATTCAGAAGCAGAAGTCTCTCAAGGGCATAGCAGTACCAACCAAGACAATGGAATTGTGCTATTGCAGGA
CATGAGAACAAGAGTTAAAATCATCGAGCAAGCAGTTGTTGGGGAAAAGAAGAGGCTTGGAAAGCAGAGAAGACGAAGCT
CTTCCCACAGAAGCAGAGACCGCAGGCTGCTTGAAGAGACTGAACATGAGGACAAATTCTCTGGTGAATTCAGACAGCCT
AGATCACCTGCAATAACTGAGATGAGAAATGGTTCATTGATGAAAGACATTCCTCTTGATCATGTTGCAGACTCTCCGTT
CTATGGAAGAAGCCGGAGAACTAGCCGTGGCTCCAATGACCAGATGCTTGAGTTATGGGAAGAATCTGCTGAGCCAGAAT
CTAGCATCAAGTCTCTGATGAACTCAAAGAAGCCTACCCTTCCCCGTCTTCACCGCAGAAGCAGGAATCCGTCTATTGAA
TCACAGTCTGAGAAAGTTGTTGACAAGTTAGAGTTATCTAAAAGCGCTGAGGAGAACGCAAAGATCATGGAGAGACTTTT
GGCTGATTCTCGAAGACTTGCAAGCCTTAGAGTCATCCTGAGAGATCTGAAAAGCAAGCTGGATCTGAGCGAGAAACCAG
GCAAGTTCACTAATCCCGAATTTGCTAGAGTGAGGAAGCAGCTGAAAGAAATAGAAGACGCCATCCTTCAGCTTGAAAAC
ACAAACGAGATTCTTGCCAAGGAAATTGAGGAGACTGGAGACGCCAGAGATATCTACAGAAAGGTGGTTATAGAGAAGTC
AAGAATTGGATCCGAGAAGATTGAGCTGATGGAGCAAGAAATGCACAACATTGAGAGAACAGTGCTAAAGCTTGAAGATG
GAGCAGCCAAAAGTAAAGGAAAGACAAAGTTCTCTGAGAGTAGGACAGTGATACTCTTGAGAGACATTATCCACAAAGGT
GGGAAAAGGACAGCAAGGAAGAAGAAAAACCGTTTCTGTGGCTGCATGAGATCTTCTTCAGCTAAGGAAGAGTAG