Details for Chinese cabbage Locus Brara.E01978

Position : A05 ( 5`- 18010108 .. 18011112 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01978

Protein [Map View]
MREETFLFQWRFLASCFIFFLILPQAFTYNTPPINPCSPHAPNWFPPIANPRLLKAYAALQAWKFTMTSDPNGFTSNWCG
PHVCNYTGVFCAPTLDNPYLLTVAGIDLNHANIAGYLPEELGLLTDLALFHINSNRFKGQLPMSLNCLKLLHELDVSNNK
LSGEFPSVVFTLPSLKFLDIRFNGFYGDVPSQLFDLNLDALFINNNNFRFRLPGNIGNSTVSVLVLANNDLQGSCVPPSF
YNMGKTLHEVILTNSQISGCLNREIGLLTQLTVFDVSFNNLVGSLPETMGDMKSLEQLNIAHNKFSGYIPEGICRLPNLE
NFTYSYNFFSAEPPA

DNA
ATGAGAGAAGAAACTTTCTTGTTCCAATGGCGTTTCTTAGCCTCTTGTTTCATCTTCTTCCTCATCCTTCCTCAAGCTTT
CACTTACAATACTCCTCCCATCAACCCCTGCTCCCCACATGCTCCTAATTGGTTTCCTCCCATCGCAAACCCAAGGCTCT
TAAAAGCTTACGCAGCTCTTCAAGCTTGGAAATTCACTATGACTTCAGACCCAAACGGCTTCACCTCTAACTGGTGTGGT
CCTCATGTTTGTAACTACACAGGCGTCTTCTGTGCACCGACTCTAGACAACCCGTACCTCTTAACCGTAGCCGGTATAGA
CTTAAACCATGCCAACATCGCTGGTTATCTCCCAGAAGAGCTTGGTCTCTTAACCGATCTTGCGTTATTCCATATCAATT
CCAACCGGTTTAAAGGTCAACTCCCTATGTCTCTAAACTGCCTCAAACTTCTCCACGAGCTTGACGTCAGCAACAATAAA
CTCTCCGGCGAGTTTCCTTCCGTAGTCTTCACGTTACCTTCTTTAAAGTTTCTTGACATTAGGTTTAATGGTTTCTACGG
TGATGTTCCTAGCCAACTCTTTGACCTAAACCTTGACGCTCTCTTCATTAACAACAACAACTTCCGGTTTAGGCTACCGG
GAAACATAGGAAACTCTACAGTTTCGGTTCTTGTCTTAGCCAACAACGATCTCCAAGGATCTTGTGTACCTCCGAGTTTC
TACAACATGGGGAAAACGTTACACGAGGTCATTCTCACGAATAGTCAGATTAGCGGTTGTTTAAACCGGGAGATCGGTTT
GCTAACCCAGTTGACGGTTTTTGACGTAAGTTTTAATAACTTGGTCGGTTCTTTGCCGGAGACTATGGGTGATATGAAGA
GTTTGGAGCAGTTAAACATCGCTCATAACAAATTCTCCGGCTACATTCCGGAGGGTATCTGCCGACTACCGAACCTCGAG
AACTTCACTTACTCGTATAACTTTTTCTCCGCCGAGCCACCGGCT