Details for Chinese cabbage Locus Brara.E01977

Position : A05 ( 5`- 17995854 .. 17998009 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01977

Protein [Map View]
MDPSYRFIKEEFPTGFIVSSSPPSSSTYSYLYSTSMVPNDPTTSSSPQPIEGLHESGPPPFLTKTYDLVEDSRTNLVVSW
SQAKNSFIVWDPQAFSTTLLPRFFKHNNFSSFVRQLNTYGFRKVNPDRWEFANEGFLRGQKHLLKTIRRRKTSNNNQIQP
PQSSSQEHSLDNCCIEVGRYGLDGEMDSLKRDKQVLVMELVKLRQQQQSTKVYLKLIEEKLKKTESKQQQMMSFLARAMQ
NPDFLQQLMEQKEKRKEMEEAISKKRQRPIDQGTRNVVTVEDYDDDDGGAIGGYGRYGNDAGSSSAYMKQETYGDLSGFE
MSELDSLAMHIQGLGNQFTREEVLDVEKRDEEGEQEGYQKVNNEIYGEGFWEDMLNEGQNFDFEGDEENVDVLIEQLGYL
GSSSN*

DNA
ATGGATCCTTCATATAGATTCATAAAAGAGGAGTTTCCTACTGGATTCATTGTTTCCTCATCACCACCATCTTCATCAAC
TTATTCTTACCTCTATTCAACCTCCATGGTCCCAAATGATCCAACAACATCAAGCTCTCCACAGCCAATAGAAGGTCTCC
ACGAATCAGGCCCACCTCCATTTCTGACAAAGACATATGACTTGGTCGAAGATTCAAGAACCAACCTTGTTGTGTCTTGG
AGCCAAGCCAAAAACAGCTTCATTGTCTGGGATCCACAAGCTTTTTCCACCACTCTCCTCCCCAGATTCTTCAAGCACAA
TAACTTCTCTAGCTTTGTTCGCCAGCTCAACACATATGGTTTCAGAAAAGTGAATCCGGATCGGTGGGAGTTTGCAAATG
AAGGGTTTCTTAGAGGGCAAAAGCATCTCCTCAAGACAATAAGGAGAAGAAAGACAAGTAACAATAATCAAATACAACCA
CCTCAATCATCCTCACAAGAACATTCTCTAGACAACTGTTGCATAGAAGTTGGTAGGTATGGTCTAGATGGAGAGATGGA
CAGCCTAAAACGAGACAAACAAGTGCTGGTGATGGAGCTAGTGAAACTGAGACAGCAACAACAAAGCACCAAAGTGTATC
TCAAATTAATTGAAGAGAAACTCAAGAAAACTGAATCAAAACAACAGCAAATGATGAGCTTCCTCGCCCGCGCAATGCAG
AATCCTGATTTCCTTCAACAACTCATGGAGCAGAAAGAGAAAAGAAAGGAGATGGAAGAAGCAATCAGCAAGAAGAGACA
AAGACCAATCGATCAAGGGACAAGAAATGTGGTTACTGTGGAAGATTATGATGATGATGATGGTGGTGCTATAGGTGGTT
ATGGAAGGTATGGAAATGATGCTGGATCCTCCTCAGCGTACATGAAACAAGAAACGTATGGAGACTTGTCTGGATTCGAG
ATGTCCGAGTTGGACAGTCTTGCTATGCATATTCAAGGACTTGGAAATCAGTTCACTAGAGAAGAAGTCTTGGATGTTGA
GAAAAGAGATGAAGAAGGAGAACAAGAAGGGTACCAAAAGGTGAACAATGAGATTTATGGTGAGGGTTTTTGGGAAGATA
TGTTAAATGAAGGTCAAAATTTTGATTTTGAAGGAGATGAAGAAAATGTTGATGTGCTCATTGAACAACTTGGTTATTTG
GGTTCTAGTTCAAACTAA