Details for Chinese cabbage Locus Brara.E01973

Position : A05 ( 5`- 17949443 .. 17953649 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01973

Protein [Map View]
MERRQARSSKIHVFVFVGLILLSSIERISSLSVTVSDDECVQEYVLYEGDNVSGNFVVVDHDIFWGSDHPGLDFTVTSPA
GNIVHTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHDLAKDEHLDPVNVKIAELREALESVVSE
QKYLKARDTRHRHTNESTRKRVIFYTVGEYIFLAAASGLQVLYIRKLFSKSVAYNRV*

DNA
ATGGAGAGAAGACAAGCGCGGAGCTCGAAGATCCATGTCTTTGTATTCGTCGGTCTGATACTGTTGAGCTCGATCGAGCG
AATCTCATCGCTCTCGGTTACTGTTAGCGACGATGAATGCGTACAAGAGTATGTCCTCTACGAAGGAGATAACGTCTCCG
GAAACTTCGTCGTCGTCGACCATGATATCTTCTGGGGATCTGATCATCCCGGTTTGGATTTCACGGTGACGTCACCTGCT
GGGAACATAGTACATACGTTGAAGGGAACATCAGGAGATAAGTTTGAGTTCAAGGCACCAAGAAGTGGAATGTACAAGTT
CTGTTTCCACAACCCTTACTCTACTCCTGAAACTGTCTCCTTCTACATTCACGTTGGTCATATCCCCAACGAGCATGACT
TAGCTAAAGACGAGCATTTGGACCCGGTGAATGTTAAGATAGCTGAGCTGAGAGAGGCTTTGGAGTCTGTTGTTTCTGAG
CAAAAGTATTTGAAAGCACGTGATACCCGTCACCGTCATACAAATGAGAGCACGAGAAAGCGAGTGATATTCTACACAGT
AGGAGAGTATATATTCCTAGCAGCAGCAAGTGGTCTTCAGGTTCTCTACATCCGCAAGCTCTTCAGCAAGTCGGTTGCAT
ACAACAGAGTTTGA