Details for Chinese cabbage Locus Brara.E01970

Position : A05 ( 5`- 17857192 .. 17859581 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01970

Protein [Map View]
MASMSAVLSKSPFLSQPLSKSPSSDLPFSAATVSFPSKSHRRGGVIRAGLISPDGGKLVELVVAEPRRREKKHEAGELPR
VELTAIDVQWMHVLSEGWASPLGGFMRESEFLQTLHFNSLRLDDGSVVNMSVPIVLAIDDEQKASIGESKRVALVGSDGN
PVAILSDIEIYKHPKEERIARTWGTTAPGLPYVEEAITNAGNWLIGGDLEVLEPVKYNDGLDRFRLSPAELRKELEKRGA
DAVFAFQLRNPVHNGHALLMTDTRRRLLEMGYKNPILLLHPLGGYTKADDVPLSWRMKQHEKVLEDGVLDPETTVVSIFP
SPMHYAGPTEVQWHAKARINAGANFYIVGRDPAGMGHPVEKRDLYDADHGKKVLSMAPGLERLNILPFRVAAYDKTQGKM
AFFDPSRPQDFLFISGTKMRTLAKNKENPPDGFMCPGGWQVLVDYYDSLTPAGKLPVPA*

DNA
ATGGCTTCCATGTCTGCCGTCCTCAGCAAATCCCCTTTCCTCTCTCAGCCTCTCTCCAAATCTCCATCCTCCGATCTCCC
CTTCTCCGCCGCAACCGTCTCTTTCCCCTCGAAATCGCACCGTCGCGGCGGAGTAATCCGCGCCGGACTCATCTCCCCCG
ACGGCGGGAAGCTCGTGGAGCTCGTAGTGGCGGAGCCGCGACGGCGGGAGAAGAAGCACGAGGCGGGGGAGCTGCCACGC
GTGGAGCTCACGGCGATCGACGTGCAGTGGATGCACGTGCTGAGCGAAGGCTGGGCAAGTCCGCTCGGAGGCTTCATGAG
AGAATCCGAGTTCCTCCAAACTCTTCATTTCAACTCGCTTCGTCTTGACGACGGATCCGTCGTCAACATGTCCGTGCCTA
TCGTCCTCGCTATTGACGACGAGCAGAAGGCTAGTATCGGCGAGTCCAAACGCGTCGCGCTTGTTGGTTCCGACGGTAAC
CCCGTCGCTATCCTCAGCGACATTGAGATTTACAAACATCCCAAGGAAGAGAGAATAGCAAGAACTTGGGGTACGACGGC
TCCAGGCTTGCCTTACGTAGAAGAAGCCATTACCAACGCTGGAAACTGGCTGATTGGGGGTGATCTCGAGGTTCTTGAGC
CAGTCAAGTACAATGATGGGCTTGATCGTTTTAGGCTTTCCCCTGCTGAGCTTCGCAAGGAGCTGGAGAAGCGTGGCGCG
GATGCTGTCTTTGCTTTCCAGCTTAGGAACCCGGTTCACAACGGTCATGCACTTCTTATGACTGATACTCGGAGGAGACT
TCTTGAGATGGGATACAAAAACCCTATTCTTTTGCTTCATCCGTTAGGAGGGTACACAAAGGCTGATGATGTTCCTCTAA
GTTGGAGGATGAAGCAGCACGAGAAGGTGCTAGAGGACGGTGTTCTTGATCCAGAGACTACAGTAGTTTCGATATTCCCG
TCTCCTATGCATTATGCTGGTCCAACCGAAGTGCAGTGGCACGCAAAGGCGAGAATCAATGCCGGTGCAAACTTTTACAT
TGTGGGTCGTGATCCAGCCGGGATGGGTCACCCAGTTGAAAAACGTGATCTCTACGATGCCGATCATGGAAAGAAAGTAC
TAAGCATGGCCCCTGGACTTGAAAGACTCAATATCCTTCCTTTCAGGGTTGCTGCATATGACAAGACACAAGGCAAAATG
GCTTTCTTTGATCCCTCGAGGCCTCAAGATTTCTTGTTCATCTCCGGCACTAAGATGCGCACATTGGCCAAGAACAAAGA
AAACCCTCCGGATGGATTCATGTGCCCAGGTGGATGGCAAGTTCTTGTTGATTACTATGACAGCTTGACTCCAGCAGGTA
AACTACCGGTTCCGGCCTAA