Details for Chinese cabbage Locus Brara.E01967

Position : A05 ( 5`- 17819866 .. 17824221 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01967

Protein [Map View]
MGETKQQLELTQEQIMEFKEAFCLFDKDGDGCITADELATVIRSLDQNPTEQELQDMINEIDSDGNGTIEFSEFLNLMGS
KIQETDADEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVDQMIKEADLDGDSQVNYDEFVRMMMTSG*

DNA
ATGGGTGAGACAAAACAACAGCTGGAACTGACGCAAGAACAGATAATGGAGTTTAAAGAGGCCTTTTGTCTGTTCGACAA
AGATGGAGATGGTTGCATCACTGCTGATGAACTTGCTACTGTGATCCGCTCGTTGGATCAGAATCCAACCGAACAAGAGC
TTCAAGACATGATCAATGAGATCGACTCCGATGGTAACGGCACCATCGAATTCTCTGAGTTCCTCAACCTCATGGGCAGC
AAAATCCAGGAAACTGATGCAGATGAGGAGCTGAAAGAAGCATTCAAAGTGTTTGACAAAGACCAAAATGGTTACATCTC
TGCTAGTGAGTTGAGGCACGTGATGATCAATCTTGGGGAGAAGCTCACGGATGAGGAGGTTGATCAAATGATTAAGGAGG
CAGATTTGGATGGTGATAGTCAAGTCAATTATGATGAATTTGTGAGGATGATGATGACCAGCGGTTAA