Details for Chinese cabbage Locus Brara.E01966

Position : A05 ( 5`- 17815769 .. 17816773 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01966

Protein [Map View]
MRNCKKRPRRPTRSQGRPSRDLFYQTLTDYSDEETQGILQFMKKLKQADDETCIFNRFCCGIDSYRYGCINYISLKNRLL
WILRDHKGLLDEFHQLKSGFASPVIRNNEKKKENAESDMERTVGFLKKIEALGESVYKAFINAVAFSGDIEVLVEQLDEI
LRDHTPLKEDFETFLVDSRLLKRKREESVEDTPSYQIRPEAEVRSSSNGVFNEKYYLVSPYDPEVASQNEHQRCLNKKRN
NLEDKLMKEDMLMGDLDAVIRFGKDPKLFEKPPLGFDRVLDWFCGGKEVPQKYKTHPKLAVTYMLPIMQITLEEMTRAKT
VKAISANESEGEVK*

DNA
ATGAGAAACTGCAAGAAGAGACCACGACGACCTACGAGGAGTCAGGGAAGACCGTCAAGAGACTTGTTTTATCAAACTCT
GACTGATTATTCAGATGAAGAGACTCAAGGAATCTTACAGTTCATGAAGAAACTGAAACAGGCCGATGATGAAACATGCA
TCTTCAATCGATTCTGCTGTGGGATTGACTCTTATCGATATGGTTGTATAAACTACATCAGTCTCAAAAACCGTCTCCTT
TGGATTCTCCGTGATCACAAAGGTTTACTCGACGAGTTCCATCAGCTTAAGTCAGGTTTTGCTTCTCCTGTAATAAGAAA
CAACGAGAAGAAGAAAGAGAACGCAGAATCAGACATGGAGCGTACGGTAGGGTTCTTGAAGAAAATCGAAGCCCTAGGGG
AGAGTGTGTACAAAGCGTTTATAAATGCGGTAGCGTTTTCCGGTGATATAGAGGTTCTGGTTGAACAACTCGACGAGATT
CTACGCGACCACACGCCTCTAAAAGAGGATTTTGAAACGTTCTTAGTTGATTCCCGTTTACTCAAACGCAAACGTGAAGA
AAGCGTGGAGGACACGCCATCGTATCAGATTAGACCCGAAGCTGAAGTGCGATCTTCCTCTAATGGGGTTTTTAACGAGA
AATACTATTTGGTCAGTCCGTATGATCCCGAGGTCGCATCGCAAAACGAGCACCAGCGTTGCCTCAATAAGAAAAGGAAT
AACCTCGAGGACAAACTTATGAAGGAGGACATGCTCATGGGTGACCTAGATGCGGTTATTAGGTTTGGTAAAGACCCCAA
ACTCTTCGAGAAGCCTCCATTAGGATTTGACAGAGTCTTGGACTGGTTTTGCGGAGGTAAGGAGGTGCCACAAAAATATA
AGACACATCCGAAGCTTGCGGTAACATATATGTTACCGATAATGCAGATTACGCTAGAAGAGATGACAAGGGCGAAAACA
GTTAAAGCGATAAGTGCCAACGAGTCGGAGGGTGAAGTTAAGTAA