Details for Chinese cabbage Locus Brara.E01965

Position : A05 ( 5`- 17787001 .. 17788920 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01965

Protein [Map View]
MPFMMKIQPIDIDSPAVRETAARPVLKSRLKRLFDRPFTNVLRNATSEKPLHGGEVQCGGGAAVTEFEPSSVCLAKMVQN
FIEETNEKQAKCGRNRCNCFKGNNDDSSSDDDFDLFGGSTESFIGDASDHLKSLVTCVSVAERNLLADAAKIVDKNRSVK
RKEDLRKLLNEGLLSLHYDSSLCKSKWEKSPSFPAGEYEYIDVIVGEERLLIDVDFRSEFDIARQTSGYKALLQSLPFIF
VGKSDRLTQIVSLISEAAKQSLKKRGMHLPPWRKAEYMRSKWMSSYTRASVVASGNAEEPPATVAAAEPELDDCAELELV
FEEKSLSPGVINSSSSPFPSVYGGNDDVAVEREVKVTGLASLFKERP*

DNA
ATGCCGTTTATGATGAAGATCCAGCCGATTGATATCGATTCACCCGCCGTAAGAGAGACGGCAGCTCGACCGGTGCTCAA
ATCTCGCCTCAAGCGTTTGTTTGACCGGCCGTTCACAAACGTGCTGAGAAACGCAACCTCCGAGAAACCATTACACGGTG
GCGAAGTTCAATGCGGAGGAGGAGCGGCCGTGACGGAGTTCGAGCCGAGCTCCGTTTGCTTAGCGAAGATGGTTCAGAAC
TTCATAGAGGAAACGAACGAGAAGCAAGCCAAATGTGGACGCAACCGATGCAACTGCTTCAAGGGAAACAACGACGATAG
CTCCTCCGACGATGATTTTGATCTCTTCGGTGGTTCAACTGAGTCTTTCATCGGCGACGCCTCTGATCATCTCAAGAGTT
TGGTCACATGCGTGAGCGTCGCGGAGAGGAACCTCTTAGCCGACGCGGCGAAGATCGTTGATAAGAACAGATCAGTCAAA
CGAAAAGAGGATCTGAGGAAGCTCCTCAACGAAGGACTCTTATCTCTTCACTACGATTCTTCACTCTGCAAATCCAAATG
GGAGAAATCTCCATCATTCCCAGCTGGTGAATACGAGTACATAGATGTGATTGTTGGAGAAGAACGGTTGTTAATCGACG
TTGATTTCCGATCAGAGTTCGATATCGCGAGGCAGACGAGTGGTTACAAGGCGTTGCTTCAATCTCTACCCTTCATCTTC
GTCGGCAAATCCGATCGGTTAACTCAGATCGTCTCGTTGATCTCCGAGGCGGCGAAACAAAGCTTGAAGAAGAGAGGGAT
GCATTTGCCTCCGTGGAGGAAAGCGGAGTACATGCGATCTAAGTGGATGTCCTCTTACACCAGAGCCTCCGTCGTTGCTT
CTGGAAACGCTGAAGAGCCGCCTGCTACGGTGGCCGCGGCTGAGCCGGAGCTTGATGATTGTGCAGAGCTTGAGCTGGTT
TTCGAGGAGAAATCTTTATCTCCGGGAGTTATTAATTCTTCCTCCTCTCCTTTTCCGTCTGTTTACGGCGGTAATGATGA
TGTGGCGGTGGAGAGAGAAGTGAAGGTCACCGGCTTAGCTTCTTTGTTCAAGGAAAGGCCTTAA