Details for Chinese cabbage Locus Brara.E01963

Position : A05 ( 5`- 17749402 .. 17751630 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01963

Protein [Map View]
MQKREFAKSGGQSGGSSAPPAKRGRPFGSTSANSAAAAAAAAAAEAMSPSALLGPSLLVHNSFVVEQNNKRIVLALQSGL
KSEVTWALNTLTLLSFKERDDIRRDFTPLAKIPGLLDALLLIIDDWRDIALPKDFTSGTRVRSLGVNSSVSGFGSEYDAL
ASVQPPGSGVGSSPGETLGKKSKHQSSQWWNEEDGLFNLDDEGRAEKQLCAIAASNVIRNFSFMPDNETIMAQHRHCLET
VYQCINDHMAEDEELVTNSLETIVNLAHLMDLRIFSSSKQSYIKINEKQAVQAVLGILNSSVKAWNCAAAELLGRLIINP
DNEPFISPLIPQIHKRLVDLLSIPAVDAQAAAVGALYNLVEVNMDCRLKLASERWAIDRLLKVIKTPHPVPEVCRKAAMI
LENLVSEPQNRGLLLAYENAFAELLFQDGKYSDSFARILYELTARSNSRVASARGIWGM*

DNA
ATGCAGAAACGAGAGTTTGCGAAATCCGGCGGTCAGTCGGGTGGATCTTCGGCTCCGCCAGCGAAGAGAGGCCGTCCCTT
CGGTAGTACGAGTGCAAACTCTGCAGCTGCAGCAGCTGCGGCGGCGGCGGCGGAAGCGATGTCTCCGTCAGCTCTACTCG
GTCCTTCTCTTCTAGTTCACAATTCCTTCGTCGTAGAGCAGAACAACAAGAGAATAGTGCTGGCGTTACAGAGTGGTCTG
AAGAGCGAGGTGACATGGGCGTTGAACACACTTACACTGCTCTCCTTCAAAGAAAGAGATGATATTCGTAGAGATTTCAC
TCCTCTTGCTAAGATCCCTGGCTTGCTTGACGCCCTTCTCTTAATCATTGATGACTGGCGTGACATAGCTCTCCCTAAGG
ACTTCACAAGTGGAACTAGGGTCAGGTCTTTAGGTGTGAATTCTTCTGTTTCAGGATTCGGGAGCGAGTACGATGCTCTT
GCCTCTGTTCAACCACCTGGATCCGGCGTTGGCTCTTCACCTGGTGAGACGTTAGGGAAAAAGAGCAAACATCAGTCATC
TCAGTGGTGGAATGAAGAGGATGGTTTGTTCAATCTAGACGATGAAGGCAGAGCAGAGAAACAGCTTTGCGCCATTGCTG
CATCTAACGTCATCCGCAACTTCTCCTTCATGCCTGATAATGAAACTATAATGGCTCAGCATCGCCATTGCTTAGAAACT
GTTTACCAATGCATAAACGATCATATGGCCGAGGATGAAGAGCTGGTCACAAACTCGCTTGAGACCATTGTGAACCTAGC
GCATTTGATGGATCTTCGTATTTTCAGCTCGTCTAAACAGTCATACATCAAGATTAATGAAAAGCAAGCAGTTCAAGCTG
TCTTAGGGATTCTCAATTCTTCTGTCAAAGCTTGGAACTGTGCTGCTGCTGAACTGCTGGGGCGTTTGATAATCAATCCA
GACAATGAACCTTTCATTAGTCCCTTGATTCCGCAGATACACAAGAGACTAGTCGATCTCTTGAGCATACCAGCCGTCGA
TGCACAAGCTGCAGCTGTTGGGGCACTCTACAATCTTGTGGAAGTAAACATGGATTGTAGATTGAAGCTTGCAAGTGAGA
GATGGGCGATTGATAGGTTGTTGAAAGTGATAAAGACGCCACATCCAGTTCCAGAAGTCTGCAGGAAAGCTGCAATGATT
CTAGAGAACCTTGTCTCTGAGCCACAGAACAGAGGGTTGCTATTGGCGTATGAGAATGCTTTTGCTGAGCTGCTTTTTCA
AGATGGTAAGTATTCTGATTCGTTTGCGAGGATTTTGTATGAACTAACTGCCAGATCAAATAGCAGAGTGGCTTCGGCTA
GGGGAATCTGGGGAATGTAA