Details for Chinese cabbage Locus Brara.E01962

Position : A05 ( 5`- 17727601 .. 17730930 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01962

Protein [Map View]
MLLNLRLDGSSLHVICSTKTFPIFPLDKVPSFKKVKQNYIPGTHDGGDKGPPQRSNRHCGRGGGVGTIAREVIAGKNLLI
VNPSENRVGKSRISDGFVAKKAKDAGFNGNGMVSKVHTKCSTKGLSYGGCIPAILEALDRIENVGDALGPWEERLSNKER
TIILKEQARWERAVEIFEWFKSKECYELNVIHYNIMLRILGKARKWRYVQSLWEEMITKGIKPINSTYGTLIDVYSKGGL
KVHALCWLGKMSKIGMQPDEVTTGIVLQMYKKAREFQKAEDFFKKWSCGKDNNKMEPHVCLSSYTYNTMIDTYGKSGQIK
EASETFKRMLEEGIVPTTVTFNTMIHMYGNNGQLGEVTSLMKTMKLQCLPDTRTYNILISLHTKNNDIERAGAYFKEMKH
AGLKPDPVSYRTLLYALSIRHMVEEAEDLIAEMDHNDVEIDEYTQSALTRMYIEAEMIEKSWFWFQRFHLAGRMSSEGYS
ANIDAYGERGYLKEAERVFICCQEVNKRTVIEYNVMIKAYGIGKSCEKACEVFESMMSYGVAPDKCTYNTLVQILASSDM
PHKARSYLEKMRETGYVSDCIPYCAVISSFVKLGQLNMAEEVYKEMVDFNIEPDVVVYGVLINAFADTGNVQEAMSYVEA
MGKAGITGNSVIQSSLIKLYTKVGYLNEAEAVYRELLESCNTAQYPDVYTSNCMINLYSERSMVRKAEAIFESMKQRGEA
NEFTFAMMLCMYKKNGRFEEATQVAKQMREMKILTDPLSYNSVLGLYALDGRFKEAVETFKEMVSSGVRPDDSTFKSLGT
ILIKLGLSKKAVLRIEDVRKQEMKRGLELWISTLSSLVGIQSNTEDCDEL*

DNA
ATGTTGTTGAATCTTCGTCTCGATGGAAGTAGCTTACACGTTATCTGTTCGACCAAAACCTTTCCCATCTTCCCTCTCGA
TAAAGTCCCATCCTTCAAGAAAGTGAAGCAGAATTACATACCAGGAACCCACGACGGTGGTGACAAGGGACCACCGCAGA
GAAGCAACAGACACTGCGGCCGTGGTGGAGGCGTCGGTACTATTGCCCGTGAAGTTATCGCCGGAAAAAACTTACTTATC
GTAAACCCAAGTGAGAATCGCGTCGGAAAGTCAAGGATTAGTGATGGGTTTGTCGCTAAGAAGGCTAAAGATGCCGGATT
TAATGGAAACGGTATGGTTAGTAAAGTGCATACCAAGTGCTCGACGAAAGGTCTGAGTTACGGAGGATGCATTCCCGCTA
TTCTGGAGGCTCTCGATCGTATTGAGAACGTTGGAGATGCGTTGGGTCCGTGGGAGGAGAGGCTTAGCAATAAGGAGAGG
ACGATTATCTTGAAAGAGCAAGCACGGTGGGAGAGAGCGGTGGAGATTTTCGAGTGGTTTAAGAGCAAAGAATGCTATGA
ACTGAACGTGATTCATTACAATATCATGCTCAGGATTCTTGGGAAAGCTCGTAAATGGAGGTATGTGCAGAGTCTATGGG
AAGAAATGATTACAAAAGGCATCAAACCCATTAACTCAACGTATGGGACTCTCATTGATGTCTATAGCAAAGGCGGGCTT
AAAGTACACGCCCTATGTTGGTTAGGGAAGATGAGTAAGATTGGGATGCAGCCTGATGAAGTCACAACGGGTATCGTTCT
TCAAATGTATAAAAAGGCAAGAGAGTTTCAGAAAGCAGAGGACTTTTTCAAGAAATGGTCGTGCGGCAAAGACAACAACA
AGATGGAACCACACGTTTGCTTGAGCTCTTATACGTACAACACGATGATTGATACGTATGGTAAGTCGGGACAGATCAAA
GAGGCTTCAGAGACGTTCAAGAGGATGCTAGAAGAAGGGATTGTGCCAACCACAGTGACTTTCAACACCATGATTCATAT
GTATGGCAACAACGGCCAGCTTGGAGAAGTGACTTCCTTGATGAAAACGATGAAGCTTCAGTGCTTACCTGATACAAGAA
CATACAACATTCTCATTTCCCTCCACACGAAGAACAACGATATCGAACGAGCAGGAGCCTACTTCAAGGAAATGAAACAC
GCTGGTCTTAAACCGGACCCTGTAAGTTACCGAACCCTCCTTTACGCGTTGTCGATAAGACATATGGTTGAGGAAGCTGA
GGACCTTATAGCGGAGATGGATCATAATGATGTCGAGATCGATGAGTACACGCAATCTGCTCTCACTAGAATGTATATAG
AAGCGGAGATGATTGAGAAATCATGGTTTTGGTTCCAAAGGTTTCATCTCGCGGGTAGAATGAGCTCTGAAGGCTATTCA
GCCAACATTGATGCGTACGGCGAGCGTGGATATCTAAAAGAAGCCGAGAGAGTGTTTATCTGCTGCCAAGAAGTGAACAA
GAGAACGGTTATCGAGTACAATGTGATGATCAAAGCGTATGGAATCGGTAAAAGCTGTGAAAAGGCTTGTGAAGTATTCG
AGAGCATGATGAGTTATGGCGTCGCACCGGATAAGTGTACATACAACACTCTCGTCCAGATCCTTGCTAGCTCCGACATG
CCTCATAAAGCCAGATCGTACCTGGAGAAAATGAGAGAGACGGGTTATGTGAGCGATTGCATACCTTACTGCGCTGTGAT
ATCGAGCTTTGTGAAACTTGGTCAGCTCAATATGGCAGAGGAGGTCTATAAAGAGATGGTTGACTTCAATATAGAGCCTG
ATGTTGTTGTCTACGGAGTCTTGATCAATGCTTTTGCGGATACTGGAAACGTTCAAGAAGCTATGAGTTATGTAGAAGCG
ATGGGAAAAGCTGGAATCACAGGAAACTCTGTTATACAGAGTTCTCTGATTAAGCTCTACACTAAAGTCGGATACTTGAA
CGAAGCTGAAGCTGTCTACAGAGAGCTTCTTGAATCGTGTAACACGGCGCAGTATCCAGACGTATACACATCTAACTGTA
TGATCAACCTCTACAGCGAAAGGTCGATGGTGAGGAAAGCAGAAGCGATATTCGAGAGCATGAAACAGAGAGGAGAAGCA
AACGAGTTCACTTTCGCGATGATGCTATGCATGTACAAGAAGAACGGTAGGTTTGAAGAAGCCACTCAGGTAGCGAAACA
GATGAGAGAGATGAAGATTCTCACTGATCCTTTGAGTTACAACAGCGTTCTTGGGTTATACGCTTTGGACGGGAGGTTTA
AAGAAGCTGTTGAGACTTTTAAAGAGATGGTTTCGTCGGGAGTTAGACCAGATGACTCGACGTTTAAGTCGCTTGGGACC
ATTCTGATCAAACTCGGCTTGTCGAAGAAAGCTGTCCTTAGGATTGAAGATGTGAGGAAACAAGAGATGAAGAGAGGTTT
GGAGTTATGGATCTCGACTCTCTCTTCTCTTGTTGGGATTCAGAGCAATACTGAAGATTGTGATGAGCTTTAG