Details for Chinese cabbage Locus Brara.E01960

Position : A05 ( 5`- 17717037 .. 17718010 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01960

Protein [Map View]
MAYEKVNELNLKDTELRLGLPGTGQVKEEKEVSCVRSNKRQHQSDNEEESTPPTKTQIVGWPPVRSYRKNNNSVVSYVKV
SMDGAPYLRKIDLKTYKNYSELLKELENMFKFTIGEYSEREGYRGSGVVPTYEDKDGDWMLVGDVPWDMFSSSCKRLRIM
KGSDALALDSAL*

DNA
ATGGCGTACGAGAAAGTCAACGAGCTTAACCTTAAGGACACAGAGCTTCGTCTTGGATTACCTGGAACAGGGCAAGTAAA
GGAAGAAAAAGAAGTTTCTTGTGTTAGAAGCAACAAGCGTCAACACCAAAGCGATAACGAGGAAGAATCTACGCCTCCTA
CGAAAACTCAAATCGTTGGTTGGCCTCCGGTGAGATCTTACCGCAAGAACAACAACAGTGTTGTGAGCTATGTGAAAGTG
AGTATGGACGGAGCTCCTTACCTACGTAAAATCGATCTCAAAACATACAAAAACTATTCAGAGCTTCTCAAGGAGTTAGA
GAACATGTTCAAGTTCACAATAGGTGAATACAGCGAAAGAGAAGGATACAGAGGATCTGGAGTTGTACCAACGTACGAGG
ATAAAGATGGAGACTGGATGTTGGTTGGTGATGTTCCATGGGATATGTTCTCTTCTTCTTGTAAGAGACTCAGAATCATG
AAAGGATCCGATGCTCTTGCTTTAGACTCTGCCTTATGA