Details for Chinese cabbage Locus Brara.E01956

Position : A05 ( 5`- 17652676 .. 17655238 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01956

Protein [Map View]
MDESSYRNLTDFLRRSSVTETLVDILLCSVPPIMIGLLIGWSWRPRWTGLVYLGLRSKLRFLCTVPPGFGARRVWLAFTA
LSLCRTFWSRLGSSDKKPEDSGETEAISRVSDKEDTEKEQEIVREKDLEHLLHLLEAENANMEWQSMMDKSTPNMNYQAW
RHEPQTGPVVYRSRTVFEDATPDIVRDFFWDDEFRPKWDPMLAYFKTLEEDPQTGTTIVHWIKKFPFFCSDREYIIGRRI
WESGNKYYAVTKGVPYPALPKRDKPRRVEIYFSSWIIKAVESRKGDGQMSACEVSLVHCEDMGIPKDVAKLGVRHGMWGA
VKKLNSGLRSYQTARKAGAALSRSAQIARITTKLNMDVAEISRVDEEERGRDMENARRPKDQFSVDWKLIVVGGVALACG
LHSSAIGKALMFGAGQRLARR*

DNA
ATGGACGAATCATCTTATCGTAACCTCACGGACTTCCTCCGGAGAAGCTCTGTTACAGAGACATTGGTGGACATCTTGCT
ATGCTCAGTTCCTCCTATCATGATCGGGCTTTTGATTGGCTGGTCTTGGCGTCCGAGGTGGACCGGTTTGGTTTATCTAG
GTCTCCGTTCTAAGCTCCGTTTTCTATGCACTGTTCCGCCCGGTTTCGGAGCTCGCCGTGTTTGGCTTGCTTTCACCGCT
CTCTCACTGTGTCGCACTTTCTGGTCAAGGCTCGGTTCGAGTGACAAGAAACCAGAAGATAGTGGTGAAACAGAAGCTAT
CTCAAGAGTTAGTGATAAAGAAGATACAGAGAAAGAGCAGGAGATTGTGAGAGAGAAGGATCTAGAGCATTTGCTGCATC
TGCTTGAAGCTGAAAATGCTAATATGGAGTGGCAATCTATGATGGACAAGTCTACTCCCAATATGAACTACCAGGCCTGG
CGACATGAGCCTCAGACAGGGCCTGTTGTTTATCGTAGTCGGACTGTTTTTGAGGACGCAACTCCAGACATTGTTAGGGA
TTTCTTCTGGGACGACGAGTTTCGACCTAAATGGGATCCTATGCTTGCTTACTTCAAAACATTGGAGGAAGATCCTCAGA
CAGGAACAACTATTGTTCACTGGATTAAAAAGTTTCCGTTTTTCTGTAGTGACCGGGAATACATCATTGGCCGGAGAATA
TGGGAATCTGGAAACAAGTATTATGCTGTGACTAAGGGAGTACCGTATCCAGCTCTACCAAAGCGTGATAAACCGAGGCG
AGTTGAGATTTATTTCTCAAGTTGGATCATCAAAGCGGTTGAATCTCGAAAAGGGGATGGACAAATGTCAGCTTGCGAAG
TCTCTCTTGTCCACTGCGAAGACATGGGAATCCCAAAAGACGTAGCAAAGTTGGGAGTCCGTCATGGCATGTGGGGAGCC
GTCAAAAAGCTAAACTCCGGGTTAAGGTCTTACCAAACCGCTAGAAAAGCAGGGGCGGCTCTGTCAAGGAGCGCGCAAAT
TGCGAGAATCACTACGAAACTGAACATGGATGTGGCTGAAATATCGAGGGTAGATGAAGAAGAGAGAGGGAGAGACATGG
AGAACGCAAGGAGGCCAAAGGATCAGTTCAGTGTAGATTGGAAGTTGATCGTTGTAGGAGGAGTTGCACTGGCGTGTGGG
CTTCATTCAAGTGCTATTGGCAAGGCCTTAATGTTTGGAGCTGGGCAGAGACTTGCTCGTAGGTGA