Details for Chinese cabbage Locus Brara.E01955

Position : A05 ( 5`- 17648626 .. 17651147 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01955

Protein [Map View]
MDICMDKEPDGVVVYANGDSCNPIQENVSVLPPLDSVPSDEANGNTELLSTEESIEVKEYDVKECTNEIPVAKPLEDGNM
EMATLRKDAKSVNKSVLHAKHVSKPGRGSNKIRNTVPQPFALATAKRASSATRESHEVADMYSKIQKQVIKVPRKPLQPK
NKKLSDEEEDSCSVASYATSAAKSAKSRTIVTAAPSFRSTERAEKRKEFYTKLEEKHQAMEAEKTQSEARNKEENDAALR
QLRKSLMFKANPMPNFYHEGPPPKVELKKPPPTRAKSPKLGRRNTKEGNRSKGVSRRHETRKTLIVIAKEDSDDATTQKS
DQINQFAAEEVNRNLKPEPETAFAC*

DNA
ATGGATATCTGTATGGACAAGGAGCCAGATGGTGTGGTGGTCTATGCTAATGGTGATTCTTGTAACCCAATCCAAGAAAA
TGTTTCTGTACTGCCTCCCTTAGATTCAGTACCAAGCGATGAAGCCAATGGAAATACAGAGCTTCTATCTACAGAAGAGA
GCATAGAAGTAAAAGAATACGATGTTAAGGAGTGTACTAATGAGATTCCAGTTGCTAAGCCTTTGGAAGATGGCAATATG
GAGATGGCTACCTTGAGAAAAGACGCTAAGTCGGTAAACAAGTCTGTTTTGCATGCAAAACATGTTTCTAAACCAGGTCG
TGGGAGTAATAAAATAAGGAACACTGTTCCACAGCCATTTGCTTTAGCTACTGCAAAGCGTGCTTCATCTGCTACCCGTG
AGTCTCATGAAGTAGCAGATATGTACAGTAAAATACAAAAGCAGGTTATAAAGGTACCAAGGAAACCATTGCAGCCAAAG
AACAAGAAGCTCTCTGATGAGGAAGAAGATTCTTGCTCTGTTGCTTCTTATGCCACGTCAGCTGCAAAGTCTGCTAAATC
AAGAACCATTGTCACTGCAGCTCCTTCGTTTCGATCCACCGAGCGTGCAGAGAAGAGGAAGGAGTTCTATACAAAACTAG
AAGAGAAACACCAAGCCATGGAGGCAGAGAAAACGCAGAGCGAAGCAAGGAACAAGGAAGAGAACGATGCAGCATTGAGG
CAATTAAGAAAGAGTTTGATGTTCAAAGCAAACCCAATGCCTAACTTCTACCATGAAGGGCCTCCTCCAAAGGTTGAACT
TAAGAAGCCTCCTCCAACTCGAGCAAAGTCGCCAAAACTAGGGCGTAGAAACACAAAAGAAGGGAACAGATCCAAAGGAG
TTTCGAGGCGCCATGAAACTCGAAAGACTTTAATAGTGATCGCTAAAGAAGACAGTGATGATGCAACCACACAGAAATCT
GACCAGATAAACCAGTTTGCTGCAGAGGAAGTGAACCGAAATTTGAAACCGGAACCGGAGACTGCTTTTGCTTGCTAA