Details for Chinese cabbage Locus Brara.E01512

Position : A05 ( 5`- 9889823 .. 9890790 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01512

Protein [Map View]
MMHTPQQQQSLASHFHLYPLVEKLTDAIETGTRDDALQVTELNSHFDKCQQLLNSISGSKTMTVDGQKRNLEESEQLLQE
RRVLMVEYRNSIEDLLKMEA*

DNA
ATGATGCATACACCGCAGCAACAACAGTCATTAGCTTCTCATTTCCATCTCTATCCGTTGGTCGAGAAATTAACAGATGC
AATTGAAACTGGAACGCGAGATGATGCACTGCAGGTGACTGAATTGAACAGCCATTTTGACAAGTGTCAGCAGCTCTTGA
ATTCCATTTCAGGATCTAAAACCATGACTGTTGATGGACAAAAGAGAAATCTAGAAGAAAGTGAGCAATTGCTTCAAGAA
AGAAGGGTCTTGATGGTGGAATATAGGAATTCTATTGAAGACCTTCTCAAGATGGAGGCTTAG