Details for Chinese cabbage Locus Brara.E01511

Position : A05 ( 5`- 9885222 .. 9886234 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01511

Protein [Map View]
MSEEGPKLFTNKPKKKGKMFKQTKKALKHLEAYGSTMSGDSVPPPPQPPKESFARRYKYVWPLLLTVNLAAGGYLFLRPK
KKDIDSLSEEIAAKSNSAAAASVTMAKPAPSAVVAEPVVIKAREPIPEKQQRELFKWILEEKRKVKPRNAQEKKRIDQEK
AILKQFIGSKTIPTL*

DNA
ATGAGTGAAGAAGGTCCCAAGCTTTTCACGAATAAACCCAAGAAGAAAGGTAAAATGTTTAAACAAACAAAAAAAGCTCT
CAAGCACCTCGAAGCCTACGGTTCCACGATGAGTGGTGACTCTGTTCCTCCTCCTCCTCAGCCTCCGAAAGAATCATTCG
CTCGACGGTACAAATATGTCTGGCCTCTTCTCCTCACCGTTAATCTCGCCGCCGGAGGGTACCTTTTCTTGAGGCCTAAG
AAAAAGGATATCGATTCTTTAAGTGAAGAGATTGCTGCTAAATCAAATTCAGCCGCTGCGGCTTCTGTTACCATGGCAAA
GCCTGCGCCTTCTGCAGTGGTTGCAGAGCCTGTTGTGATCAAGGCACGTGAGCCAATACCGGAGAAGCAACAACGTGAGC
TCTTCAAATGGATCTTGGAGGAGAAAAGAAAAGTGAAACCGAGAAATGCGCAAGAGAAGAAGAGGATTGATCAAGAAAAA
GCCATTCTGAAACAGTTCATTGGATCCAAAACCATTCCTACTCTCTGA