Details for Chinese cabbage Locus Brara.E01509

Position : A05 ( 5`- 9873741 .. 9874575 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01509

Protein [Map View]
MTNYGAIPTSSHPSPPVDLEYISHVKHRLKAGLATRRPWRSMFDLESMTVPHGFLDAISRMKTNLVYFRANYAIAVLFML
FVSLLYHPTSLLVLAILVVFWIFLYFLRDEPLVLFGHQVDDRTVMISLSALTIGMLLFTHATGNILGSLLTAVVLVLIHA
GVRRSDNLYSDEEAAAATETSGLASYPSS*

DNA
ATGACGAACTACGGCGCGATTCCGACGTCGTCTCATCCATCTCCTCCGGTGGATCTCGAGTACATCTCACACGTCAAGCA
CCGTCTCAAAGCAGGTCTAGCCACGCGCCGGCCATGGAGGTCGATGTTCGATCTGGAATCAATGACTGTTCCTCACGGTT
TCTTGGACGCGATCTCGAGAATGAAGACGAATCTCGTCTACTTCAGAGCAAACTACGCCATCGCCGTCCTCTTCATGCTC
TTCGTAAGCCTTCTCTACCACCCGACCTCGCTCCTCGTCTTAGCCATCTTGGTCGTCTTCTGGATCTTCCTCTACTTCCT
CCGCGACGAGCCTCTCGTGCTCTTCGGTCACCAGGTCGACGATCGGACGGTCATGATCTCTCTCTCGGCGTTGACCATCG
GTATGCTTTTGTTCACCCACGCCACGGGGAATATTCTCGGATCGCTGTTGACCGCCGTCGTGTTGGTTCTGATCCACGCG
GGGGTTAGGAGGAGTGATAATTTGTACTCCGATGAGGAAGCTGCGGCCGCGACTGAAACTTCAGGGCTGGCGTCATACCC
TTCCTCGTGA