Details for Chinese cabbage Locus Brara.E01507

Position : A05 ( 5`- 9856059 .. 9857194 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01507

Protein [Map View]
MGTLVGHVAPGFAFFVLGLWHLYNNIKLFSLHPNTFNSSPWFPTSKFRHLELYLIMLSSSASIAMELFIGPKKHQPFDSD
GTIPSNHLHNFEHSSISMSFLVYAVFALVLDQARPKAVSKELTILAAASTFAQQLFLFHHHSADHMGIEGQYHKLLQLVI
FVSLLTTLMGIALPKSFLVSFVRSSSIAFQGVWFIVMGYMLWTPILISKGCFLHEEKGHQVVRCSSDLALHRAKSLVNIE
FSWFFVGNTIFVMSLYLILDGVYGENIEYSSLTTKDQVEEDGEKQEDIESLKMSNPGFVQMGKIFGDRDVER*

DNA
ATGGGAACACTTGTGGGACATGTTGCGCCAGGTTTTGCCTTCTTTGTACTTGGTCTTTGGCACTTATACAACAACATAAA
ACTATTTTCTCTACACCCAAACACCTTTAATTCATCACCATGGTTCCCAACTTCCAAGTTCAGGCACCTAGAGCTCTACT
TAATCATGCTCTCTTCATCAGCCTCCATAGCCATGGAGCTCTTTATTGGGCCCAAGAAACATCAACCCTTTGACTCTGAT
GGCACCATACCCTCAAACCACCTCCACAACTTTGAACATTCCTCTATATCTATGTCCTTCTTAGTCTACGCTGTTTTTGC
ACTAGTCCTTGATCAAGCAAGGCCTAAAGCCGTCTCTAAGGAACTGACCATACTCGCGGCAGCCTCTACCTTTGCTCAAC
AACTCTTCTTATTCCATCATCACTCTGCTGACCACATGGGCATCGAGGGACAATACCATAAGCTCCTCCAGCTTGTCATC
TTTGTTTCTCTCCTTACCACTTTAATGGGTATTGCCTTGCCTAAAAGTTTCTTGGTAAGTTTTGTGAGATCATCAAGCAT
AGCTTTCCAAGGAGTGTGGTTTATAGTGATGGGCTACATGCTTTGGACACCTATCTTGATCTCCAAGGGGTGTTTTCTTC
ATGAAGAAAAAGGGCATCAAGTGGTTAGATGTTCAAGCGACTTAGCTCTACACAGGGCTAAGTCGCTGGTCAACATCGAG
TTTAGCTGGTTTTTTGTTGGAAACACAATATTTGTTATGTCTCTATATTTGATTCTTGATGGAGTTTACGGTGAAAATAT
CGAATACTCAAGTCTAACCACTAAAGATCAAGTTGAAGAAGATGGTGAAAAACAAGAAGACATCGAGTCGTTGAAGATGA
GTAATCCAGGTTTTGTCCAGATGGGTAAAATTTTTGGAGATCGAGACGTGGAAAGGTGA