Details for Chinese cabbage Locus Brara.E01506

Position : A05 ( 5`- 9841668 .. 9842413 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01506

Protein [Map View]
MASSITFSCLFLSLLSLSTALSSPDLHRPSLSSGDVHDLLPRYGFPKGLLPDNVKSYTLSDGGDFTVDLNTPCYVDFPGQ
TVFYEKKIAGKLSFGSVKDVEGIKAKELFIWASITAMKSDPSSGDIVFSVGFVSKSLPASMFNNVPSCSKKLSLES*

DNA
ATGGCTTCTTCGATCACATTCTCCTGCCTCTTCCTCTCTCTCCTCTCTCTCTCCACCGCTTTATCATCTCCAGATCTCCA
CCGCCCATCTCTGTCCTCCGGTGACGTCCACGATCTCCTCCCTCGCTACGGATTCCCCAAAGGTCTTCTTCCGGATAACG
TCAAATCGTACACTCTCTCCGACGGCGGAGACTTCACCGTCGACTTAAACACTCCCTGCTACGTCGACTTCCCCGGTCAA
ACCGTTTTCTACGAGAAGAAGATCGCCGGGAAGCTCAGCTTCGGATCTGTGAAAGACGTGGAAGGAATCAAAGCTAAAGA
ACTTTTCATCTGGGCATCGATCACCGCCATGAAATCGGATCCAAGCTCTGGAGATATTGTCTTCTCCGTCGGATTCGTAT
CCAAGTCTTTGCCGGCGTCTATGTTCAATAATGTTCCCTCTTGCTCCAAAAAACTTAGTCTTGAATCTTAA