Details for Chinese cabbage Locus Brara.E01505

Position : A05 ( 5`- 9839403 .. 9841302 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01505

Protein [Map View]
MDLSSQRQSPNSSRGFRLQAPLVDSVSCYCRVDSGLKTVVEARKFVPGSKLCIQPDINPNAHRRSKNSKRERTRIQPPLL
PGLPDDLAVACLIRVPRAEHRKLRLVCKRWYRLASGNFFYSQRKLLGMSEEWVYVFKRDRDGKISWNTFDPVSQHPQPLP
PVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMRRVIFYNARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGI
QRTLRSAEVYDPNKNRWSFVADMSTAMVPLIGVVYDKKWFLKGLGSHQQVMSEAYDPETNSWRPVSDGMVTGWRNPCTSL
NGRLYGLDCRDGCKLRVFDETTDSWNKFMDSRVHLGNSRALEAAALVPLNNKLCIIRNNMSMSLVDVTNPDKNNPRVWEN
IAVKGQSKSILSNLWSSIAGRAVKSHIVHCQVLQA*

DNA
ATGGATCTATCTTCCCAACGACAATCCCCAAATAGTTCCAGGGGGTTTCGCCTTCAAGCTCCATTGGTGGATTCCGTATC
TTGCTACTGCAGAGTAGATTCAGGTCTCAAGACCGTTGTAGAAGCTAGAAAGTTCGTTCCTGGCTCAAAGCTTTGTATCC
AACCCGACATCAACCCCAATGCTCATCGTCGCAGCAAGAACTCTAAGCGAGAGAGGACAAGAATCCAACCTCCGCTTCTC
CCTGGCCTCCCCGACGACCTAGCCGTCGCTTGTCTCATCCGTGTCCCTCGTGCAGAGCATAGGAAACTCAGGCTTGTGTG
TAAGAGATGGTACAGGCTTGCTTCTGGTAACTTTTTCTACTCTCAGAGGAAGCTACTTGGGATGTCTGAAGAATGGGTTT
ATGTTTTTAAGAGAGATCGTGATGGGAAGATCTCTTGGAACACGTTTGATCCTGTCTCCCAGCATCCTCAGCCGCTTCCA
CCTGTTCCTAGAGAGTATTCTGAAGCTGTTGGGTTTGGTTGCGCTGTTCTAAGCGGTTGTCATCTTTATTTGTTTGGAGG
TAAAGATCCGTTAAGAGGATCAATGAGGAGGGTTATTTTCTATAATGCCAGGACGAATAAGTGGCATAGAGCACCGGATA
TGCTTAGGAAGCGACACTTCTTTGGTTCTTGTGTCATTAACAACTGCTTGTATGTAGCGGGTGGGGAGTGCGAAGGGATA
CAGAGGACACTACGCTCAGCTGAGGTTTATGATCCGAACAAGAACAGGTGGAGTTTTGTTGCTGATATGAGCACAGCGAT
GGTGCCTCTTATCGGTGTGGTTTATGACAAGAAGTGGTTTCTCAAGGGTCTTGGCTCTCACCAACAGGTCATGAGTGAAG
CTTATGACCCTGAGACTAACTCATGGAGGCCGGTCAGTGACGGGATGGTTACCGGTTGGCGAAACCCGTGTACTTCTCTA
AACGGTCGTCTCTACGGATTGGACTGTAGAGACGGGTGTAAGCTCAGGGTGTTTGATGAAACCACGGATTCATGGAACAA
GTTCATGGACAGTAGAGTACACTTGGGAAACTCGAGGGCGCTTGAAGCTGCGGCTCTTGTCCCGCTGAACAATAAGCTTT
GTATAATACGGAACAACATGAGCATGAGTCTGGTTGATGTAACGAATCCTGATAAGAACAACCCTCGAGTATGGGAAAAC
ATTGCGGTGAAAGGACAGTCCAAGAGCATACTAAGTAATTTATGGTCGAGTATCGCAGGGAGAGCTGTGAAAAGCCATAT
TGTGCATTGCCAAGTGCTTCAAGCCTAA