Details for Chinese cabbage Locus Brara.E01503

Position : A05 ( 5`- 9820760 .. 9823626 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E01503

Protein [Map View]
MRGRSYTPSPPRGSYGRRGRRSPSPRGGRYGGARSVDLPTSLLVRNLRHDCRQEDLRRSFEQFGPLKDIYMPRDYYTGDP
RGFGFVQFVDPADAAEAKYQMDGYHLLGRELTVVFAEENRKQPTEMRARERGGGRSIRSRDRRRSPPRYYSRSPPPRRGR
SRSGSDDYYSPPSRRHHSRSISPGEERYARGRSYSRSSAYNGSRGRSVTPARSKRRSISRSPSPGISISPSPRRNVSRSP
SPRRSRSNTPVPARGRSPRRKRRSNTPIPTRSSPKRKRSNTPIPARSRSPKRKRSNTPIPARNRSQREEEYEDRSPSQ*

DNA
ATGAGGGGAAGGAGCTACACTCCGTCACCACCAAGGGGGAGTTATGGGAGGAGGGGTCGAAGAAGCCCAAGCCCTAGAGG
AGGCCGTTACGGTGGAGCTCGTAGCGTGGACCTCCCGACCAGTCTCTTGGTTCGCAATCTACGCCATGACTGCAGGCAAG
AAGATCTCAGGAGGTCATTCGAGCAGTTTGGGCCTCTTAAGGACATCTATATGCCTAGGGATTACTATACTGGAGATCCG
CGAGGGTTTGGTTTCGTACAGTTTGTGGATCCTGCTGATGCTGCGGAGGCAAAATATCAAATGGATGGTTACCATCTACT
TGGGCGTGAGCTGACTGTTGTGTTTGCAGAAGAGAACAGGAAGCAACCGACTGAAATGAGAGCAAGGGAGCGTGGTGGAG
GAAGGAGCATCAGGTCTCGAGACAGGAGGCGTAGCCCCCCTCGTTACTACTCTCGCTCTCCTCCACCTCGACGTGGTAGA
TCTCGATCAGGGAGTGATGATTATTATTCTCCTCCCTCTAGAAGACATCACTCAAGGTCTATCTCTCCCGGGGAAGAACG
ATATGCTAGAGGGAGGTCATACTCACGATCATCCGCCTATAATGGCTCCAGGGGTCGCAGTGTAACTCCAGCTAGAAGTA
AGAGACGCAGCATAAGCCGTAGCCCAAGTCCAGGAATAAGCATTAGCCCTAGTCCGAGAAGAAACGTAAGCCGTAGTCCA
AGCCCGAGGAGAAGCAGGAGCAACACACCTGTACCAGCCAGAGGCCGCAGCCCAAGGAGAAAGAGGAGGAGCAACACACC
TATACCAACCAGAAGCAGCCCTAAGAGAAAGCGGAGCAACACACCTATACCAGCCAGAAGCCGCAGCCCTAAGAGAAAGA
GGAGCAACACACCTATACCAGCTAGAAACCGCAGCCAGCGTGAGGAGGAGTACGAAGACCGTTCACCAAGCCAGTGA