Details for Chinese cabbage Locus Brara.E00194

Position : A05 ( 5`- 1088813 .. 1091189 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E00194

Protein [Map View]
MGLRMSESAKPYFAMVCLQFGYAGMNLLTKTVLDRGMSHYVLVAYRNAFATAAIAPFAFLSERKVRSKMTFSIFMHIFVL
ALLGPVIDQNLYYIGLRLTSPTFSSAVSNIVPAITFILATLFRMEKVEMKKVRCQVKVVGTLVTVAGSILMILYKGPFIN
FFRSHLTTTATASSPLAGDYFKAAVFLLLASLSWASFFILQAWTLKKYAAHLSLSTMVCFMGTLQSLALAFVMEHNPSAL
NISFDMNLLASAYAGIMSSSIAYYVQGLMMQRKGPVFVTAFNPLVVVIVSIMSFFVLGQGIYLGGVIGLVVLMVGVYAVL
WGKHVDDDDKETRCEDNILVTVKCCSGNSDLSMMPTIDEADEDVETGKVQAVEKETSLVVVVFCRENVDNVSRC*

DNA
ATGGGACTAAGGATGTCAGAATCAGCTAAACCTTACTTTGCAATGGTCTGTCTTCAGTTTGGATACGCCGGTATGAACCT
GCTCACTAAAACCGTCCTTGACCGCGGTATGAGCCATTACGTTCTTGTTGCATACCGCAACGCTTTTGCCACAGCCGCGA
TCGCACCTTTCGCATTTCTTTCTGAAAGGAAAGTGAGGTCAAAGATGACGTTTTCGATATTCATGCACATATTTGTTCTT
GCTCTTCTCGGGCCTGTAATTGATCAGAATCTATATTACATCGGTCTGAGACTCACATCTCCGACGTTTTCCTCCGCCGT
CAGCAACATCGTGCCCGCAATAACCTTTATCCTCGCCACTCTATTCAGGATGGAGAAAGTGGAGATGAAAAAAGTAAGAT
GCCAAGTAAAAGTAGTGGGGACTTTAGTGACAGTGGCTGGATCCATATTGATGATATTATACAAAGGTCCTTTCATCAAT
TTCTTCCGATCTCACCTCACCACCACCGCCACCGCATCTTCGCCGCTGGCCGGTGATTATTTTAAAGCCGCCGTCTTCCT
CCTTCTCGCTTCCCTCTCATGGGCTTCCTTCTTCATTCTCCAGGCATGGACTTTGAAGAAATACGCAGCCCATCTCTCGT
TATCAACCATGGTGTGTTTCATGGGAACGTTACAATCCTTAGCCCTGGCATTCGTAATGGAACACAATCCTTCTGCTTTG
AACATCAGTTTTGACATGAACCTTCTAGCTTCTGCCTACGCGGGAATAATGTCGTCGAGCATAGCTTACTACGTTCAAGG
ACTTATGATGCAGAGAAAGGGACCTGTCTTCGTCACTGCTTTTAACCCTCTTGTTGTCGTCATTGTCTCCATAATGAGCT
TCTTCGTTCTCGGCCAAGGAATCTACCTAGGAGGGGTTATTGGGCTGGTTGTTTTAATGGTGGGAGTCTACGCCGTGTTA
TGGGGCAAACACGTAGACGATGATGACAAAGAAACACGCTGTGAAGATAACATTTTAGTTACCGTTAAGTGTTGTAGTGG
CAATAGTGATCTCTCGATGATGCCAACAATCGATGAAGCTGATGAGGATGTTGAAACGGGTAAAGTTCAGGCGGTTGAGA
AGGAAACATCGCTGGTGGTTGTGGTTTTTTGCCGTGAAAATGTGGACAACGTTTCACGATGCTAA