Details for Chinese cabbage Locus Brara.E00190

Position : A05 ( 5`- 1068879 .. 1073037 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E00190

Protein [Map View]
MMISQTSCFWEERLKNYNKTKDKIPTMTKVCPEMQEKKVCEAVVVVEAISADVSFASNQFPSYKLGPDDQIVDEPKENEK
HPSVKDVVDKETGDLSDQHKRLSVRDLACKFDKNLAAAAKLVDEAKLSEVTSLEGHVMLKKLRDALESMRGRMDGRNKEA
VEKAISMVEALAVKLTQHEGGFIQEKTEVKKLANFLKQASEDAKKLVNQERSFACAEIDSAKTLVMRLGGAFEEQEISSK
ASRAQGPNVEKLVEEVQEARRIKRMHQPTKVMGMQHELHDLKSQIQEKSAYSIKLQREIAIIKRAEGSKSCPYVLNGAQT
LGSCLKIRASSDSNASDISKCSFQWYRAASESSRREAISGANQSIYAPEPYDVGRVIQADILCNGQKFTVTTEGPINTAS
GLQSRVESLMRKSNSEFTVVISQMNGQDHVSRSHVFTVGKARVKLSRGWITKAREIYSNSMQLCGVRGNANAPAKALFWQ
PRKGLSFLLTFESEQERNAAIVLSRKYAYDCNVTLVGPDD*

DNA
ATGATGATCAGTCAAACGAGCTGTTTTTGGGAAGAGAGACTCAAAAATTACAACAAGACCAAAGATAAGATTCCGACAAT
GACTAAAGTATGTCCTGAAATGCAAGAAAAGAAAGTGTGTGAAGCAGTAGTGGTAGTTGAAGCAATTTCAGCAGATGTGA
GCTTTGCTTCTAACCAGTTTCCATCATACAAGCTAGGACCTGATGATCAGATTGTTGATGAGCCTAAAGAAAATGAAAAA
CATCCATCTGTTAAAGATGTTGTGGACAAAGAAACAGGAGATTTGTCAGATCAGCACAAGCGGCTTTCAGTTCGTGACCT
TGCTTGCAAATTCGACAAGAATCTAGCTGCAGCTGCTAAACTAGTTGATGAGGCAAAGTTGAGTGAGGTGACTTCATTGG
AAGGACATGTTATGCTAAAGAAACTTAGAGATGCTTTAGAATCCATGAGAGGTCGTATGGATGGGCGTAACAAGGAAGCA
GTTGAAAAAGCTATCTCTATGGTTGAGGCTCTAGCAGTTAAGTTAACTCAACATGAAGGTGGGTTTATTCAAGAAAAGAC
TGAAGTGAAGAAACTGGCAAACTTCCTTAAGCAGGCTTCAGAAGATGCAAAGAAGTTAGTAAACCAGGAACGTTCGTTTG
CTTGTGCTGAAATAGATAGTGCAAAGACTCTTGTGATGAGACTTGGAGGAGCATTTGAAGAACAGGAGATTTCTTCTAAA
GCTTCTCGAGCTCAGGGTCCGAATGTGGAGAAACTGGTTGAGGAAGTTCAGGAGGCTAGAAGAATCAAAAGGATGCATCA
ACCAACCAAGGTGATGGGCATGCAACATGAGCTACATGATTTAAAGAGTCAAATCCAAGAGAAGTCTGCATATTCCATTA
AGCTTCAAAGAGAGATAGCAATAATCAAAAGAGCCGAAGGGTCCAAATCATGTCCTTATGTTCTAAATGGTGCACAAACT
CTTGGCTCGTGCCTAAAGATACGTGCCTCCTCGGATAGTAATGCTTCAGATATTTCCAAATGTTCATTCCAGTGGTACCG
TGCAGCATCTGAGTCTAGTCGTAGAGAAGCTATATCCGGTGCCAACCAATCAATATATGCTCCAGAACCATATGATGTGG
GGAGGGTAATACAAGCAGACATTCTTTGTAACGGTCAGAAGTTCACTGTTACAACAGAGGGTCCAATTAATACTGCTTCT
GGCTTGCAATCACGTGTAGAATCACTCATGCGAAAATCTAACAGTGAATTCACTGTGGTTATATCACAGATGAATGGGCA
AGATCATGTATCGCGATCTCACGTCTTTACTGTCGGAAAGGCGAGGGTAAAGCTGTCTCGAGGATGGATCACAAAGGCTA
GAGAAATATATTCAAACTCCATGCAGTTATGTGGAGTGAGAGGCAACGCTAATGCTCCTGCAAAAGCATTGTTCTGGCAA
CCAAGAAAGGGTCTAAGTTTCTTGCTGACTTTTGAGTCAGAACAAGAACGTAATGCAGCTATTGTTCTCTCCCGTAAATA
CGCATATGATTGCAATGTTACTCTGGTTGGGCCAGACGATTGA