Details for Chinese cabbage Locus Brara.E00186

Position : A05 ( 5`- 1044876 .. 1046931 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E00186

Protein [Map View]
MDPNSNNTKSIKRKVVDQLVQGYEFATQLQLLLSHQHSSQYISQTRIVSGDLDPVDELIAKILSSFHKTISVLDSCDSVP
MAVKGSPDASRGDDLAAPVSCNGGDSGDSRKRLGVGKGKRGCYTRKKRWHTWTVEASRIDEDKYAWRKYGQKEILNSKFP
RSYFRCTHKPTRGCKATKLVQKQEQDPSLFQITYIGHHTCNVSDQTHANTEPNDHGVVMDSDNALAATIAQDHVNANIQE
QEQENDISSLIVVGAGMVKEEDNNNGNQNKNYCEGSSVDGDLSLAWQDVMMMFDGHQHHQNHYYQGETSTASHQFSFIDN
DQLFSLFDPYCPYEGTNAI*

DNA
ATGGATCCAAATAGTAACAACACCAAATCCATAAAGAGAAAAGTTGTCGACCAACTCGTCCAAGGCTACGAGTTCGCTAC
TCAGCTTCAGCTTCTCCTCTCTCATCAACACTCAAGTCAGTACATCAGTCAGACCCGTATTGTTTCTGGCGATCTGGATC
CAGTTGATGAGCTCATCGCTAAGATCTTGAGTTCTTTCCACAAAACCATATCGGTTCTTGATTCTTGTGACTCCGTCCCT
ATGGCCGTTAAGGGTTCACCGGATGCTTCACGTGGTGATGATTTGGCGGCTCCTGTGAGTTGCAACGGTGGAGATTCCGG
GGATAGTAGGAAGAGACTTGGGGTTGGGAAGGGCAAAAGAGGATGCTACACTAGAAAAAAGAGATGGCATACTTGGACTG
TGGAAGCTAGTAGAATCGATGAAGACAAATATGCTTGGAGGAAATATGGACAAAAAGAGATTCTTAATTCCAAATTCCCA
AGAAGTTACTTTAGATGCACACACAAGCCAACACGAGGATGCAAAGCAACGAAACTAGTTCAAAAACAAGAGCAAGACCC
TAGTTTATTTCAAATCACATACATTGGCCACCATACATGTAATGTTAGTGACCAAACACACGCAAATACCGAGCCTAATG
ATCACGGAGTAGTCATGGATTCGGACAATGCATTGGCTGCAACCATTGCTCAAGACCATGTTAATGCAAATATACAAGAG
CAAGAGCAAGAGAACGACATCAGTAGTCTGATTGTAGTAGGTGCAGGCATGGTGAAGGAGGAGGACAATAACAATGGTAA
TCAGAATAAGAACTATTGTGAGGGTTCTTCCGTAGATGGCGATTTATCATTGGCGTGGCAAGACGTGATGATGATGTTTG
ATGGTCATCAACATCATCAGAATCACTACTATCAAGGTGAAACTAGTACTGCTTCTCATCAGTTCTCTTTCATTGACAAC
GATCAACTCTTCTCCTTATTCGATCCATACTGCCCTTACGAAGGAACAAATGCCATATGA