Details for Chinese cabbage Locus Brara.E00175

Position : A05 ( 5`- 1003346 .. 1006495 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E00175

Protein [Map View]
MADLQERMSLSSSSSSSSSSSLSLSTMAIDGELWMVAEERAQEILNAIQPVFVSDKSRNEIIDYVQTLIKDRLGIEVFLF
GSVPLKTYLPDGDIDLTVLTPQDKEEDLANALCSMLRAEDGGESDFHVTDVQYIPAQVKVIKCSIRNIAVDISFNQMAGL
CALCFLEQVDQIFGKDHLFKRSIILIKAWCYYESRILGANTGLISTYALAVLVLHIINISYSSLSGPLAVLFKFLDYYAS
FDWDSYCVTVNGPVPISSLPDMPSNDAEVVLNEKFFRECIELYSVPTKAVEANGHYFPVKHFNIVDPLKHSNNLGRSVTK
GNLQRIRHAFTLGARKLKDVLSVPGEAMGWKLEKFFCSSLERNGKGQRQDVEEPVVAFGTGRAEASELRGDFEGYFKSLV
YGKGFHGETQHKWIPQGQGQDHTSSWDIVRWFVAGQKNDFHRRNMNGSSNSLQNMRRSRGTGTYIPEMSQQSYTERFSGK
PSTVNSLPSASQSQLVKQNI*

DNA
ATGGCTGATCTTCAAGAGAGGATGTCACTCTCCTCATCTTCATCCTCCTCATCATCATCGTCTCTGTCACTATCAACAAT
GGCAATAGATGGAGAGCTCTGGATGGTTGCCGAGGAAAGGGCTCAGGAGATACTAAACGCCATCCAACCTGTCTTTGTCT
CAGACAAAAGCAGGAACGAGATCATCGATTATGTCCAGACCCTTATTAAAGATCGTCTTGGAATTGAGGTCTTCTTGTTT
GGCTCGGTGCCACTAAAAACATATCTACCAGATGGAGATATTGATCTGACAGTCCTAACTCCTCAAGATAAAGAGGAGGA
CTTGGCTAATGCATTGTGCAGTATGCTTAGAGCTGAAGACGGAGGAGAATCTGATTTCCATGTAACTGATGTTCAATACA
TCCCAGCACAGGTTAAGGTCATAAAATGCAGTATCAGGAACATTGCTGTAGACATCTCCTTCAATCAAATGGCTGGACTC
TGCGCATTATGTTTCTTAGAGCAGGTTGACCAGATTTTTGGGAAGGACCATCTGTTCAAGCGTAGCATCATCTTGATCAA
AGCTTGGTGCTACTATGAGAGCCGCATCCTCGGCGCCAACACTGGATTGATTTCGACTTATGCATTGGCAGTACTAGTCT
TGCATATCATCAACATCTCTTATTCATCACTCTCTGGTCCTTTAGCTGTGCTGTTTAAGTTCTTGGATTACTATGCATCA
TTTGATTGGGACAGCTACTGTGTAACTGTCAACGGTCCAGTCCCCATATCTTCTCTGCCTGATATGCCTAGTAATGATGC
TGAGGTTGTCCTGAACGAGAAGTTCTTCAGAGAGTGCATTGAGTTGTATTCGGTTCCAACTAAAGCTGTTGAAGCAAATG
GTCATTACTTCCCTGTGAAGCATTTCAACATAGTGGATCCTTTGAAGCACAGTAACAACCTTGGCCGTAGTGTGACAAAA
GGCAATTTGCAACGTATAAGACATGCTTTTACTCTGGGAGCTAGGAAGCTCAAAGATGTGCTCTCAGTGCCTGGAGAAGC
CATGGGATGGAAACTGGAGAAGTTCTTTTGTAGCTCGTTGGAGAGGAACGGCAAGGGACAGAGACAAGACGTGGAGGAGC
CTGTCGTGGCGTTTGGCACTGGGAGAGCAGAAGCGTCTGAGCTCAGAGGAGACTTTGAAGGATACTTCAAGAGTCTTGTT
TATGGGAAAGGGTTTCACGGAGAGACTCAGCATAAGTGGATCCCTCAGGGGCAGGGGCAAGACCACACAAGTTCTTGGGA
CATTGTTCGTTGGTTTGTGGCCGGACAAAAGAATGATTTCCATCGGAGGAATATGAATGGTTCATCAAACTCGTTGCAGA
ACATGAGGAGATCAAGAGGGACAGGCACCTACATTCCTGAAATGAGTCAGCAATCTTATACAGAGAGGTTCAGTGGCAAA
CCGAGCACGGTGAACTCATTGCCTTCAGCATCTCAGTCTCAACTTGTCAAACAGAATATTTGA