Details for Chinese cabbage Locus Brara.E00166

Position : A05 ( 5`- 970980 .. 972725 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E00166

Protein [Map View]
MDPREKKRGSLKEKFQLLRSITNSHAENDTSIIMDASKYIKKLKKKVERFKGDTTAGQSSSEPTDPTIPMVTVETLEKGF
MINVFAGKNQPGMLVSVLEAFEDIGLNVLDARVSCTDSFSLHATGVENEDGEGMDSEAVKQAVTDAITSWSESSDLQS*

DNA
ATGGATCCGAGGGAAAAGAAGAGAGGTTCTTTGAAAGAGAAGTTTCAATTGCTTCGTTCAATCACTAATTCTCATGCTGA
AAACGATACATCGATCATAATGGATGCTTCTAAATATATCAAAAAGCTTAAGAAGAAAGTTGAAAGATTCAAAGGAGACA
CTACGGCAGGGCAATCTTCAAGCGAGCCCACGGATCCCACCATACCAATGGTAACAGTGGAAACCCTAGAAAAGGGTTTT
ATGATAAACGTATTCGCAGGGAAGAATCAACCAGGCATGCTTGTTTCGGTATTAGAAGCCTTTGAGGATATTGGGCTAAA
CGTTCTCGACGCTAGGGTTTCATGTACTGACTCCTTTAGCTTGCATGCCACGGGAGTCGAGAATGAAGATGGAGAAGGTA
TGGATTCTGAAGCAGTGAAACAAGCAGTGACAGATGCAATCACAAGCTGGAGTGAAAGCAGTGATCTACAGAGCTAG