Details for Chinese cabbage Locus Brara.D02498

Position : A04 ( 5`- 19636267 .. 19638734 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.D02498

Protein [Map View]
MAESITEEPPPSEFDPLFDQLHSSISDQTPIGELMSDLGFPIDADFELTFDGMEDLYLPAEDETFLLPDNGSNQEQFGDF
TPESEGSAIFGDTDKNIHRNSESPKDSDDRCSGDERTLDQLSSQGSDNRGSDVSEAVDQKVKVEEASATKRKKEDDTSDE
SRSSKYMRSGEESAVVTGEEEEEEDEKKKRARLMRNRESAQLSRQRKKHYVEELEEKVKSMHSCITDLNGKISYFMAENA
ALRQQLGPPPPPMGMYPPIWMHCPPYMVKQQGGGHVPLIPIPRLKPQNPVKAKSKKSEAKTKKVASITFLGLVFCLFLFG
ALAPVVNVSYGGISSGAFYGSYRSNYVTDQVYNQHRNRVLDTSRSNERDSVPPGNGSEPLVASLFVPRNDKLVKIDGNLI
INSILASERALASESNESKADGVVPKDRSLALPLPDVGMMEDMAKHLVRTKAEKQKALSSGFADTLKDQIKTKAASGEMQ
QWFREGVAGPMFSSGMCTEVFQFDVSSTSGAIIPASAPTNVSSEHSKNATDTQRRKNRRTLRGLAIPLPGSKHQRNSSSK
EIKPVSSMVVSVLVDPREGGDGDMDGMIGGPKSLSRVFVVVLQDSAKYVTYSCVLPRPGAPHLMTT*

DNA
ATGGCCGAATCAATCACAGAGGAGCCTCCACCTTCCGAATTCGATCCTCTGTTCGACCAATTACACAGTTCCATCTCCGA
TCAGACTCCAATCGGCGAGCTAATGTCCGATCTAGGGTTCCCAATCGACGCCGACTTCGAGCTCACTTTCGACGGCATGG
AAGATCTCTACTTACCCGCCGAAGACGAGACCTTCCTCCTCCCCGATAACGGATCTAACCAAGAGCAGTTCGGAGATTTC
ACGCCGGAGTCCGAAGGCTCTGCAATTTTCGGCGATACCGATAAGAATATTCATCGCAACAGTGAATCTCCCAAGGATTC
CGACGATCGATGCTCCGGTGATGAGCGTACCTTGGATCAACTATCGTCTCAGGGTTCAGATAATCGTGGCTCCGATGTCT
CGGAAGCTGTGGATCAGAAGGTTAAGGTGGAAGAAGCTTCTGCTACAAAGAGGAAGAAAGAGGATGATACGAGTGACGAA
TCGAGGAGCAGCAAGTACATGAGATCGGGAGAAGAGAGCGCCGTCGTCACCGGCGAGGAAGAAGAAGAAGAGGACGAGAA
GAAAAAGAGAGCGAGGCTGATGAGAAACCGCGAAAGCGCGCAGCTTTCGAGGCAGAGGAAGAAGCATTACGTGGAGGAGC
TTGAAGAGAAGGTTAAGAGTATGCATTCTTGTATAACGGATTTGAACGGGAAGATATCTTATTTCATGGCTGAGAACGCC
GCTCTAAGGCAGCAGTTGGGTCCGCCGCCGCCTCCTATGGGAATGTATCCTCCAATATGGATGCATTGTCCTCCTTATAT
GGTGAAGCAACAAGGAGGAGGACACGTGCCTTTGATCCCCATCCCTAGGTTGAAGCCACAGAACCCAGTTAAGGCCAAGA
GTAAGAAGAGTGAAGCTAAGACCAAGAAGGTTGCTAGTATTACCTTTCTTGGTCTTGTGTTTTGTCTGTTTTTGTTTGGT
GCCTTGGCTCCGGTTGTGAATGTTAGTTACGGAGGGATTAGTAGTGGTGCCTTTTATGGGAGCTATAGGTCTAATTATGT
TACTGACCAGGTTTATAATCAGCATAGGAATAGAGTTTTGGATACGTCTCGTAGTAACGAGAGAGATTCTGTACCTCCTG
GAAATGGTAGCGAGCCTCTGGTTGCATCGCTATTTGTTCCGAGGAATGATAAGCTTGTGAAGATTGATGGGAATTTGATT
ATTAATTCTATATTGGCGAGTGAGAGAGCCTTGGCTTCTGAATCAAATGAGAGTAAAGCTGACGGGGTGGTTCCTAAAGA
TCGTTCCCTTGCTCTGCCTCTACCTGACGTGGGAATGATGGAGGATATGGCTAAGCATCTCGTTAGAACCAAGGCTGAAA
AACAGAAAGCCTTATCATCGGGTTTTGCTGATACTCTGAAAGACCAAATCAAAACAAAAGCAGCCAGTGGTGAAATGCAG
CAATGGTTTCGTGAAGGTGTTGCAGGGCCAATGTTTAGCTCGGGGATGTGCACCGAAGTATTTCAGTTTGATGTCTCCTC
AACCTCTGGGGCCATTATTCCTGCATCTGCACCAACCAACGTCTCTTCTGAACACAGTAAGAACGCCACAGACACACAGA
GGCGGAAGAACAGAAGAACACTTCGCGGTCTCGCCATTCCACTCCCAGGATCAAAGCACCAAAGAAACAGCTCTAGCAAA
GAAATCAAGCCGGTTTCATCAATGGTTGTGTCAGTGCTTGTTGATCCCAGAGAAGGTGGTGATGGAGATATGGATGGGAT
GATTGGGGGACCAAAATCACTCTCCCGAGTTTTTGTTGTCGTGCTTCAGGACAGTGCAAAGTATGTAACATACTCTTGCG
TCCTACCTCGACCAGGAGCTCCTCATCTTATGACCACTTAA