Details for Chinese cabbage Locus Brara.D02490

Position : A04 ( 5`- 19606040 .. 19609161 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.D02490

Protein [Map View]
MMISQASCFWEERLKNHNKTKDKILTMTKVCPEMKARRVCEKSVVFEPISADVSFASNRFPSYKLGPDDQIIDEPEEDEK
GPSVKDVVDKETRDLSDQHKRLSVRDLACKFDKNLAAASKLVAEAKSKEVTSLEEHVMLKKLRDALEAMRGRMDGRNKDS
VEKAISMVESLAVTLTQHEGGLIQERFEVKKLASFLKQASEDAKKLVNQERSFACAEIESARDLVMRLGGEFNESERCSK
ASQDQGPNVEKLVEEVQEARRIRLMHQPTKVMGMKHEIHDLKSQIQEKSAYSVKLQREIGRIKRVEGSKSCPYVLDGAQS
LGSCLRIRASSESASDVSKCSVQWYRAASESSRREAISGANRSVYAPEPYDVGRVIQAVILSNGQKFTVTTDGPINTASG
LQSRVESLMRKSSSEFTVVISQMNGQEHASRSHVFTVGKTRIKLSRGWITKAREIYSNSMQMCGVRDNANVPAKTLFWQP
RKGLTFLLTFESEQERNAAIVLSRKYAYDCSVTLVGPDD*

DNA
ATGATGATCAGTCAAGCGAGCTGTTTTTGGGAAGAGAGACTCAAGAATCACAACAAGACCAAAGATAAGATCCTGACAAT
GACTAAAGTATGTCCTGAAATGAAAGCAAGAAGAGTGTGTGAAAAATCGGTAGTGTTTGAACCTATTTCAGCAGATGTGA
GCTTTGCTTCTAATAGATTTCCATCATACAAGTTAGGACCTGATGATCAGATCATTGATGAGCCTGAAGAAGATGAAAAA
GGTCCATCTGTTAAAGATGTCGTTGACAAAGAGACACGAGATTTGTCAGATCAACACAAGCGTCTTTCAGTTCGTGACCT
CGCTTGCAAGTTCGACAAGAACTTAGCTGCAGCTTCTAAACTAGTTGCCGAGGCAAAGTCGAAGGAGGTGACTTCATTGG
AAGAACATGTTATGCTAAAGAAACTTAGAGATGCTTTAGAAGCCATGAGAGGTCGTATGGATGGGCGTAACAAGGACTCA
GTAGAAAAAGCAATCTCCATGGTTGAGTCACTAGCCGTTACGTTAACTCAACATGAAGGTGGGCTAATTCAAGAAAGGTT
TGAAGTGAAGAAACTTGCAAGCTTCCTCAAGCAGGCGTCAGAAGATGCTAAGAAGTTAGTAAACCAAGAAAGGTCATTTG
CTTGTGCTGAAATCGAGAGTGCAAGGGATCTTGTGATGAGACTTGGTGGGGAATTTAATGAAAGTGAGCGTTGTTCTAAG
GCTTCTCAAGATCAAGGACCTAATGTGGAGAAACTAGTTGAGGAAGTTCAGGAGGCTAGAAGAATCAGACTGATGCATCA
ACCAACCAAGGTGATGGGCATGAAACATGAGATTCATGATTTAAAGAGTCAAATTCAAGAGAAGTCAGCATATTCAGTTA
AACTTCAAAGAGAGATAGGAAGAATCAAGAGAGTGGAAGGGTCCAAGTCATGTCCGTATGTTCTTGATGGTGCACAAAGT
CTTGGCTCGTGTCTAAGAATACGTGCCTCCTCAGAGAGTGCTTCAGATGTTTCCAAATGTTCAGTCCAGTGGTACCGTGC
AGCATCTGAGTCTAGTCGAAGAGAAGCTATCTCTGGTGCCAACCGATCGGTGTATGCTCCAGAACCGTATGATGTTGGGA
GGGTAATACAAGCAGTCATTCTTTCTAATGGCCAGAAGTTCACTGTTACAACCGATGGTCCTATTAATACTGCTTCTGGC
TTGCAATCACGGGTTGAATCACTCATGCGCAAATCCAGCAGTGAATTCACAGTGGTTATATCACAGATGAATGGGCAAGA
ACATGCGTCAAGATCCCACGTTTTTACTGTTGGAAAGACGAGGATAAAGCTGTCCCGTGGATGGATCACAAAGGCCAGAG
AAATATATTCAAACTCCATGCAGATGTGTGGAGTGAGAGACAATGCAAATGTTCCTGCAAAGACATTGTTCTGGCAACCA
CGAAAGGGTTTAACTTTCTTGCTGACTTTTGAGTCAGAGCAAGAACGTAATGCAGCCATTGTTCTCTCCCGGAAATATGC
ATATGACTGCAGTGTCACTCTGGTTGGTCCAGACGATTAG