Details for Chinese cabbage Locus Brara.D02489

Position : A04 ( 5`- 19603373 .. 19606018 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.D02489

Protein [Map View]
MSSTASSPQRVLQPGGYNGNDSRSSSTSSSFLRPELESTETEEAELVSVSWNQDSSCFAAGTSHGFRIYNCEPFKETFRR
DLKNGGFKIVEMLFRSNILALVGGGPNSQYPLTKVLIWDDHQSRCISEFSFRSEIRAVKLSRDWIVVVLEHKIYVYSFVD
LRLLLQIETHANPRGLCCLSHHSDTSVLACPGLLRGEIRVEHFGLNMVQTINAHDASIACMTLTLDGLLLATASTKGTLI
RIFNTMDGTRLQEVRRGVDRADIYSIALSPNVQWLAVSSDKGTVHIFSLRVRVVGEDSQSSENAALLTQGTYSNSLQGLV
SPATGTNPGSSLSFMRGVLPKYFSSEWSFAQFHVSEVTQFFAAFGSHNTVAITGMDGSFYRCSFDPVNGGEMVQQEYICF
LKTDNPPR*

DNA
ATGAGTTCGACTGCTTCGAGTCCCCAAAGAGTCCTGCAACCAGGTGGTTATAATGGTAATGACTCTCGAAGTAGCAGCAC
TTCTAGTTCCTTTCTGCGTCCAGAGTTAGAATCAACTGAAACCGAAGAAGCAGAGCTAGTTTCTGTGTCTTGGAACCAGG
ACTCCAGTTGTTTCGCTGCTGGAACAAGTCATGGTTTCCGCATATACAACTGCGAGCCTTTCAAAGAAACTTTCAGACGC
GACCTGAAGAACGGTGGTTTCAAAATCGTGGAGATGCTTTTCCGGAGCAACATCTTGGCCCTTGTTGGCGGTGGACCTAA
CTCTCAGTACCCTTTGACCAAAGTACTGATCTGGGATGATCACCAGAGCCGCTGCATCAGTGAATTTTCTTTTAGGTCTG
AGATTCGTGCGGTGAAGTTAAGTAGGGATTGGATTGTTGTTGTTCTTGAGCATAAGATATATGTCTACAGTTTCGTGGAC
CTGAGGCTTCTTCTTCAGATTGAAACTCACGCGAATCCGAGAGGATTGTGCTGCCTTTCTCATCACTCGGATACATCTGT
CTTGGCTTGCCCTGGTTTACTTCGAGGAGAGATTCGAGTTGAGCATTTTGGGCTTAACATGGTGCAAACCATAAATGCGC
ATGACGCTAGTATTGCGTGCATGACCTTGACGCTTGATGGTCTGTTGCTGGCAACTGCTAGTACAAAGGGGACACTGATT
AGAATCTTCAACACAATGGACGGAACTCGTTTGCAAGAGGTAAGAAGAGGAGTGGACAGAGCAGATATTTATAGCATTGC
ACTTTCACCAAACGTGCAGTGGCTGGCAGTATCAAGCGACAAGGGGACTGTTCATATTTTCTCTCTTAGAGTTAGGGTAG
TTGGGGAGGATTCTCAATCCAGTGAAAATGCAGCTCTCCTGACACAAGGAACTTATTCTAATTCTCTGCAAGGCCTTGTT
TCTCCAGCCACTGGTACCAATCCCGGTTCATCATTGTCTTTTATGAGAGGTGTTCTACCAAAGTATTTCAGCTCGGAGTG
GTCATTTGCACAGTTCCATGTATCAGAAGTCACACAATTCTTCGCTGCATTTGGCAGTCACAACACAGTTGCTATCACCG
GCATGGATGGAAGTTTCTACAGATGCAGCTTTGATCCTGTGAATGGGGGAGAGATGGTGCAGCAAGAATATATCTGCTTT
CTAAAGACAGATAACCCCCCAAGATAA