Details for Chinese cabbage Locus Brara.D02483

Position : A04 ( 5`- 19545512 .. 19547330 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.D02483

Protein [Map View]
MDSNSNNTKAIKRKVVDDLVEGCKFSTQLRLLLSNHHIETGLLSGDSDLANELITKILGSFHKTILVLDSFDLVPDVSFP
VAVEGSRNASCGDDSAAPASCNGGDSGDSRKRLGVGKGKRGCYIRKKRSHTWTVQAKRIDEDIYAWRKYGQKEILNSKFP
RSYFRCTHKPTQGCKATKQVQKLEQNPEMFQITYIGNHTCTLGDQTQVKTEITMDSDNSLAAATSQQDHVNANVQEQEND
ISSLIVGMVKQEEENNNGDQIKDSSEGSSTDGDLSLVWQDEMIFDDYQCHQEHYYYGETSTTSHQFSFIDNDQLSSLFDS
YCPYEGMNSR*

DNA
ATGGATTCAAATAGTAACAACACAAAAGCTATAAAGAGAAAAGTTGTAGACGACCTCGTGGAAGGCTGCAAATTCAGTAC
TCAGCTTCGGCTTCTTCTCTCTAATCACCACATCGAGACGGGTTTACTCTCTGGTGATTCAGATCTCGCTAATGAGCTCA
TCACTAAGATCTTGGGATCTTTCCATAAAACCATATTGGTTCTTGATTCTTTTGACCTCGTCCCCGACGTCTCTTTCCCT
GTGGCCGTAGAGGGTTCACGAAATGCTTCATGTGGCGATGACTCGGCGGCTCCGGCGAGTTGCAACGGTGGAGATTCCGG
AGATAGTAGAAAGAGACTTGGGGTTGGTAAGGGTAAAAGAGGATGCTACATAAGAAAGAAGAGATCGCATACTTGGACCG
TGCAAGCTAAAAGAATTGATGAAGATATATATGCTTGGAGGAAATATGGACAAAAGGAGATTCTTAATTCCAAGTTCCCG
AGGAGTTACTTTAGATGCACACACAAACCAACACAAGGATGCAAAGCAACCAAGCAAGTTCAGAAACTTGAGCAAAACCC
TGAGATGTTTCAAATCACATACATAGGCAACCACACATGTACTCTTGGTGACCAAACGCAAGTGAAGACCGAGATAACCA
TGGATTCGGACAACTCATTGGCTGCAGCCACTTCTCAACAGGACCATGTCAATGCAAATGTACAAGAGCAAGAGAACGAT
ATCAGTAGTCTGATCGTAGGTATGGTGAAGCAGGAGGAGGAGAATAACAATGGTGATCAGATTAAAGACTCTAGTGAGGG
TTCTTCAACAGACGGCGACTTGTCATTGGTTTGGCAAGACGAGATGATATTTGATGATTATCAATGTCATCAGGAGCACT
ACTATTATGGTGAGACTAGTACTACTTCTCATCAATTCTCTTTCATTGACAACGATCAACTTTCCTCCTTATTCGACTCA
TATTGCCCTTACGAAGGAATGAATTCTAGGTGA