Details for Chinese cabbage Locus Brara.D02467

Position : A04 ( 5`- 19484577 .. 19486756 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.D02467

Protein [Map View]
MVDLKEGKPVSSSSSSPSSSLSLSTMQIDVEMWKIAEERAQEILNTIQPICVADRSRNEIFAYVQTLVRNRLGTEVFNFG
SVPLKTYLPDGDIDLTVLTPQDKEEDFAKALLSILEAESGESNFHVTDVQYVPAQVKVIKCKIKNIAVDISFNQMGGLSA
LCFLEQADQIFGRDHLFKRSIILIKAWCYYESRILGANTGLISTYALAVLVLHIINIGYPSLSGPLAVLFKFLDYYASFD
WGKNCVTVHGPILISALPDITQTEHHEVVLNEKFVRECMESYSFSTKAVEANGRHFPVRYFNIVDPLKHSNNLGRSVTQG
NVQRLKHAFTLGAKKLKDVLTLPRETMGWKLEKLFGNSLERNGKGQRLDVDEPITAFGTGRSEVSELRGDCERYFQSLVY
GKWFHGEPKLWIPQGQDTSSWDTVNGQENNFYWRNVNGATSLQNMGRSRGTGTFIPKMGQQSYTDRFGSQPRTVKSSPSG
SQS*

DNA
ATGGTTGATCTTAAAGAGGGGAAGCCAGTCTCCTCATCTTCATCATCCCCATCATCATCTTTGTCACTATCAACAATGCA
AATAGATGTAGAAATGTGGAAGATTGCTGAGGAAAGGGCTCAGGAGATACTAAACACCATCCAACCAATCTGTGTTGCCG
ACAGAAGTAGGAATGAGATATTCGCTTATGTCCAAACCCTTGTCAGGAATCGTCTTGGAACTGAGGTCTTTAATTTTGGT
TCAGTGCCATTAAAAACCTATCTCCCAGATGGAGATATTGATCTGACAGTCCTAACTCCTCAAGATAAGGAGGAGGACTT
TGCTAAAGCATTGCTCAGTATTCTTGAAGCTGAAAGCGGAGAATCTAACTTCCATGTTACTGATGTTCAGTATGTCCCAG
CACAGGTCAAGGTGATAAAGTGCAAAATCAAGAACATTGCTGTAGATATCTCCTTTAATCAAATGGGAGGACTATCTGCT
TTATGTTTTCTGGAGCAGGCTGACCAAATTTTTGGGAGAGACCACCTGTTCAAACGTAGCATCATTTTGATCAAGGCTTG
GTGCTATTATGAGAGCCGTATACTCGGTGCCAACACTGGATTGATTTCAACATATGCATTGGCAGTACTAGTCTTGCATA
TTATCAACATAGGTTATCCATCACTGTCTGGCCCTTTAGCGGTACTGTTTAAGTTCTTGGATTACTATGCATCATTTGAT
TGGGGTAAGAACTGTGTCACGGTCCATGGTCCTATCCTGATATCTGCGCTTCCAGATATTACACAAACCGAGCATCATGA
AGTTGTCTTGAACGAGAAGTTCGTTAGAGAATGCATGGAGTCATATTCGTTTTCAACTAAAGCAGTTGAAGCAAACGGCC
GTCATTTTCCTGTGAGGTATTTCAACATAGTGGATCCTTTGAAACACAGTAACAACCTTGGCCGTAGTGTGACACAAGGC
AATGTGCAACGTTTAAAACATGCTTTTACTCTAGGAGCTAAGAAGCTCAAAGATGTGCTTACACTGCCTAGAGAAACCAT
GGGCTGGAAACTTGAGAAATTATTTGGTAATTCACTGGAGAGAAACGGTAAGGGACAAAGACTAGACGTGGATGAACCTA
TCACGGCTTTTGGCACTGGAAGATCAGAAGTTTCTGAGCTCAGAGGAGATTGTGAAAGATACTTCCAGAGTCTTGTATAT
GGGAAGTGGTTTCATGGTGAGCCTAAGTTATGGATCCCTCAGGGTCAGGACACAAGTTCTTGGGACACTGTGAATGGCCA
AGAGAATAATTTCTATTGGAGGAATGTGAATGGAGCAACCTCGTTGCAGAACATGGGAAGATCCAGAGGAACAGGCACTT
TCATTCCTAAAATGGGACAACAATCTTATACAGACAGGTTCGGTAGCCAACCGAGGACAGTGAAGTCATCGCCTTCAGGG
TCTCAGTCTTAA