Details for Chinese cabbage Locus Brara.D00358

Position : A04 ( 5`- 2557646 .. 2558714 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.D00358

Protein [Map View]
MPKNKKTEWQVGDPTISIVGDQFCNPYPMDLMVKRKVQSFSKDNYQVFDPSGNLLLQIDGQAWGINRKRVMTDPAGFTIL
TMRQKGMTLKNKWEVHGGESKEREDLLFTVHQSLAVSLKTSVDVFLAENNNVKKSNTCDFHASGGYSNISFKVFKSDALI
AGVGVTHKFTWGSFCKGKCNFRVRVNPEVDYAFIIALLVMVDDNEN*

DNA
ATGCCAAAGAATAAGAAAACAGAATGGCAAGTAGGAGATCCTACAATAAGCATAGTGGGAGATCAATTCTGTAATCCATA
CCCAATGGACCTAATGGTAAAGAGGAAAGTTCAAAGTTTCTCAAAAGATAATTACCAAGTGTTCGATCCAAGCGGAAACC
TCCTCCTACAAATTGATGGACAAGCTTGGGGGATTAACCGTAAAAGGGTTATGACTGATCCAGCTGGTTTCACAATCCTC
ACAATGCGCCAAAAGGGAATGACGTTGAAGAACAAATGGGAAGTGCATGGAGGAGAGAGCAAAGAGAGAGAAGACTTGCT
GTTCACGGTACATCAATCTTTAGCGGTGTCACTGAAAACATCGGTGGATGTTTTCTTGGCAGAGAACAATAATGTCAAGA
AGAGCAATACTTGTGATTTTCATGCTTCAGGTGGATACTCGAATATCTCATTCAAAGTTTTCAAATCGGATGCTCTCATC
GCTGGGGTAGGGGTCACGCATAAGTTTACATGGGGAAGTTTCTGTAAAGGGAAATGTAATTTTAGGGTGAGAGTAAATCC
AGAGGTGGATTATGCTTTCATCATTGCTTTGCTTGTTATGGTTGATGACAATGAGAATTGA