Details for Chinese cabbage Locus Brara.D00355

Position : A04 ( 5`- 2528795 .. 2530171 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.D00355

Protein [Map View]
MSQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGRVEPEAVFQTVSKTGKKTSYWPVETEAEPKAEVE
PKAETETKAEAETKTEGKVVEVLDAKVDATKVEPEANVEPKFAETETKTEGKADDEVLDAKVDPKVDAKADVEPKLVEAE
TKPPQV*

DNA
ATGTCTCAGACCGTGGTCCTCAAAGTTGGTATGTCATGCCAAGGATGCGTTGGTGCCGTCAATAGAGTCCTAGGCAAAAT
GGAAGGTGTTGAGTCATTTGACATTGATATAAAGGAACAAAAGGTGACAGTGAAAGGTAGAGTTGAGCCTGAGGCAGTTT
TTCAAACAGTTTCCAAGACTGGAAAAAAGACTTCTTACTGGCCCGTGGAGACTGAGGCTGAGCCTAAAGCCGAGGTTGAG
CCTAAGGCGGAGACTGAGACAAAAGCTGAAGCTGAGACCAAGACTGAAGGTAAGGTTGTTGAGGTACTGGATGCTAAGGT
TGATGCTACTAAGGTCGAGCCTGAGGCTAATGTTGAACCGAAATTCGCAGAAACGGAGACTAAGACCGAGGGTAAGGCTG
ATGATGAGGTACTTGATGCCAAGGTTGATCCTAAGGTCGATGCTAAGGCTGACGTTGAACCGAAACTCGTTGAAGCCGAG
ACTAAGCCACCACAAGTTTAA