Details for Chinese cabbage Locus Brara.D00354

Position : A04 ( 5`- 2525690 .. 2525984 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.D00354

Protein [Map View]
MEAHRSVSGKLQRKPMGDCANTVSRTSQQTSAFSTNPSLISSLKRLASSRSTSTCVRPVARRISADLGFPAPTSKLVLW*

DNA
ATGGAAGCTCATCGCTCTGTCTCAGGAAAATTACAGAGAAAACCCATGGGAGATTGCGCCAACACAGTCTCCAGAACCTC
CCAACAGACATCTGCTTTCTCCACGAATCCGAGTCTCATTTCCTCTCTCAAGAGATTAGCTAGTTCCAGAAGCACTTCCA
CGTGCGTCAGGCCTGTAGCTCGCCGCATCTCTGCCGATCTAGGTTTTCCGGCGCCTACGTCGAAACTCGTGCTCTGGTGA