Details for Chinese cabbage Locus Brara.D00348

Position : A04 ( 5`- 2489178 .. 2489858 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.D00348

Protein [Map View]
MASICCGGGGGSACAVRCDRRTVTPRASCVSVPVTNRRNRTENGKVSMTMADFAPVKPERKRGGSVVSREKLDEWLRDSV
VEIVRNLRESSLMVNLYAEGNGGLTTTATATNPAAEDWEAMEGRWGRGEERTPEGVVLVEKLADGEVAERDDYDGGACGE
GATSAWGIVAQGRGTDSGPVCYLLKTTRVGSGVGTVCTHFSLVKVKSFRETAVSQLNNSWLVQTGQ*

DNA
ATGGCGAGTATATGCTGCGGAGGAGGAGGAGGAAGCGCGTGTGCCGTTCGTTGCGATCGGCGAACGGTTACACCTCGAGC
TTCGTGTGTGTCGGTTCCGGTGACTAATCGACGGAATCGGACCGAGAACGGGAAAGTCTCGATGACGATGGCGGATTTTG
CACCGGTGAAGCCCGAGCGGAAACGCGGCGGATCCGTCGTGTCGAGGGAGAAGCTTGACGAGTGGCTGAGAGATTCGGTT
GTTGAGATCGTGAGGAATCTGAGAGAATCGTCGTTGATGGTGAACTTATACGCGGAAGGGAACGGAGGTTTGACGACGAC
GGCGACGGCGACGAATCCGGCGGCGGAGGATTGGGAGGCGATGGAAGGGAGGTGGGGGAGGGGCGAAGAGAGGACGCCGG
AGGGAGTTGTGTTGGTGGAGAAGTTAGCTGACGGTGAAGTGGCGGAGAGAGATGATTACGATGGAGGCGCGTGTGGGGAA
GGTGCAACGAGCGCGTGGGGGATAGTCGCGCAGGGAAGAGGGACGGATAGTGGACCGGTTTGTTACTTGTTGAAAACGAC
CCGGGTCGGGTCGGGTGTGGGGACGGTTTGTACACATTTTAGTTTGGTGAAGGTGAAGAGTTTTAGGGAGACGGCTGTGT
CGCAGTTGAATAACTCGTGGTTGGTGCAGACTGGTCAATGA