Details for Chinese cabbage Locus Brara.D00346

Position : A04 ( 5`- 2468289 .. 2469837 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.D00346

Protein [Map View]
MEEIMSMIFSGINLVKELEFSLTAQESPESLSTSLGSVSTLFGGANERLKILLARRNAYVLTLPEPKPVPMSGLDQMMMQ
QIEYDLMQDYSLREGVMQGVKNIDSGPSCGFSTPRPRRRKKDEEEETVFVAAARMGNMDTPPDDNHTWRKYGQKEILGSK
FPRAYYRCTHEKVYKCPAKKQVQRLDEDPYTFCVTYRSSHTWHFFTTSPISSTTDTTTTDGHYGSTVVKMAEALFGNLDS
VVPFGEPYFNYRSLFHGRGGDGDT*

DNA
ATGGAGGAGATAATGTCAATGATCTTCAGCGGAATCAATCTTGTTAAGGAGCTCGAGTTCAGCTTAACAGCACAAGAGTC
GCCAGAATCTCTCTCGACTTCTCTCGGTTCAGTCTCCACTCTGTTCGGAGGCGCCAACGAGCGGTTAAAAATCCTACTTG
CGAGGAGGAACGCTTACGTACTGACTCTGCCTGAACCAAAACCAGTTCCAATGTCCGGTTTGGACCAGATGATGATGCAG
CAGATTGAATATGATCTGATGCAGGACTACAGTTTAAGGGAAGGAGTGATGCAAGGCGTGAAGAATATAGACTCAGGTCC
GAGTTGCGGATTCTCGACTCCAAGGCCTCGAAGAAGGAAGAAGGATGAAGAAGAAGAAACGGTGTTTGTGGCGGCGGCGA
GGATGGGGAACATGGACACTCCGCCGGACGACAATCACACTTGGCGTAAATATGGCCAGAAGGAAATTCTTGGTTCTAAG
TTTCCTCGGGCGTACTATCGGTGCACCCACGAGAAAGTATACAAGTGTCCGGCGAAGAAACAAGTGCAACGGCTTGACGA
GGATCCTTACACGTTCTGCGTCACTTACCGTAGTTCACACACGTGGCACTTCTTCACCACTTCCCCTATTTCATCAACAA
CCGACACCACTACAACAGACGGTCATTACGGTTCCACCGTAGTTAAGATGGCCGAAGCTTTGTTCGGCAACTTAGACTCG
GTTGTTCCTTTTGGTGAACCCTACTTTAACTACCGTAGCCTCTTTCACGGAAGAGGCGGCGATGGGGATACGTGA