Details for Chinese cabbage Locus Brara.D00345

Position : A04 ( 5`- 2463327 .. 2464866 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.D00345

Protein [Map View]
MDIVSNNKAIMLKVMDQLVQGHELATKLQQLLSQHGSGRGAAGDLVAKISASFSDTISDLDSFEPIPSSLFTAVEGSQNA
SCNNDGKLEDSVDSRKRFGPVKGKRGCYKRKKRADTWTVESTLLEDAFSWRKYGKKEILNAKFPRSYFRCTHKYTQGCKA
TKQVQKLELEPRMFSITYIGNHTCDTDEVTPNINPCVHHDDGIMDSEEFKCPSLRTSMNEEEDNHHHGLSTESDLQLVWQ
EMLVFGEEHNHHHHEAIYGCGETSASIYGLDTTDLWSWQRFPVQR*

DNA
ATGGATATTGTTAGTAATAACAAAGCAATAATGCTAAAAGTTATGGACCAACTCGTTCAAGGCCATGAGTTGGCCACTAA
GCTTCAACAGCTCCTCTCTCAACACGGGTCGGGTCGTGGTGCAGCAGGGGATCTCGTGGCTAAAATCTCGGCATCTTTTA
GTGACACAATCTCTGATCTTGATTCCTTTGAACCCATCCCCTCCTCTCTCTTCACCGCCGTTGAAGGCTCTCAAAATGCT
TCCTGCAACAACGACGGCAAGCTTGAGGATTCCGTTGATAGTCGGAAAAGATTTGGACCCGTCAAGGGTAAAAGAGGATG
CTACAAGAGAAAAAAGAGAGCTGACACGTGGACTGTAGAGTCAACTCTACTTGAGGACGCATTTTCTTGGAGGAAATATG
GAAAAAAGGAGATTCTTAATGCCAAATTCCCAAGAAGTTACTTTAGGTGCACACATAAATACACTCAAGGGTGCAAGGCA
ACAAAGCAAGTACAGAAGCTAGAGCTCGAACCCAGGATGTTCAGTATCACATACATTGGAAACCACACGTGCGACACGGA
CGAAGTAACACCAAATATCAATCCTTGTGTTCATCATGATGACGGCATCATGGATTCTGAAGAGTTCAAGTGTCCTAGTT
TGAGGACCTCGATGAATGAAGAGGAAGATAACCATCATCATGGTTTGTCCACGGAGAGTGACTTGCAATTGGTGTGGCAA
GAAATGTTGGTGTTTGGAGAGGAACATAATCATCATCATCATGAGGCTATTTATGGTTGCGGTGAAACTAGTGCATCTAT
TTATGGTTTGGATACCACGGATCTTTGGAGTTGGCAGCGATTTCCGGTTCAACGATAA