Details for Chinese cabbage Locus Brara.D00342

Position : A04 ( 5`- 2443585 .. 2443917 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.D00342

Protein [Map View]
MEEAKPRKSLTSSSSRESLKTKNPFSRVLNEEDGIKSKTGLSMRKSWSTDSLGLLGNSNTLGKTCICAPTKHEGSFRCRL
HRTSATSQGAATTPLHLPKPLLPSSRLSDY*

DNA
ATGGAGGAGGCGAAACCGAGGAAGAGCTTGACAAGCAGTAGCAGCAGAGAGTCATTAAAGACCAAGAATCCGTTTAGCCG
TGTGCTGAATGAAGAAGACGGCATCAAAAGCAAAACAGGATTGTCAATGAGAAAGTCGTGGTCCACGGACTCGCTTGGTC
TGCTCGGTAACAGCAACACGTTGGGGAAGACATGCATCTGTGCTCCAACAAAGCACGAAGGGTCCTTCCGCTGCAGGCTT
CACCGTACATCGGCCACAAGCCAAGGTGCAGCTACTACGCCACTTCATCTCCCAAAGCCATTGCTTCCTTCTAGTCGTCT
CAGTGACTACTAG