Details for Chinese cabbage Locus Brara.D00341

Position : A04 ( 5`- 2432664 .. 2434914 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.D00341

Protein [Map View]
MTPQRSKRSETPQPSPQHEPNMQSSSSSSASSSLAYPPGYRFVPTDAEIIYYYLKPFSPDNKKSWPNLPIHHANIYESNP
QQLTAEYKKGNLTEWFFISERTKIKTNGQKQKRVDHNGGYWHSKAVTKKIKVKKDVVGYKTTLNYFVGKQPNGERTNWLM
QEYWLESSGHNNTVDYALCKIYLSPTAQKNMKEEDVEEVEEEAVQPRTVEIQQPQPPQFYPTPLVSHQPQPLPQFWPTEL
DSYQPQRQDNEYQEPLQAQPLNTIYQHQSQCPNNESEYQEPHQPQPLNTIYQHQSQRHNTESQYQEPHQPQPLDTIDHHQ
PQCHDSAYQNPPQPQPLDTIHYHQSQLHDIEYQEPHQSQPFDDIIHHQSHQVQFWQATSGSHQRQLQDQLPQSWAAPLDS
YPPHCHNIQYPQPQPLDAIEYQYLYQSGPLTTYKNVIESCTQDKSYGDIKKVDHALKIHLTPRGIKREVEEEEDEKRKRK
KKEGAVEAPKEELEQLINSHQNSSDNDSFFTGFVDTHLLHIDIESSISNCCLKKSPDEN*

DNA
ATGACTCCTCAGAGAAGCAAGCGCAGTGAAACGCCACAACCCTCTCCACAACACGAACCCAACATGCAGTCTTCTTCTTC
TTCTTCGGCCTCTTCGTCTTTAGCTTATCCACCGGGCTATAGGTTTGTACCAACCGACGCAGAAATCATCTATTATTACT
TGAAACCCTTCTCACCAGACAACAAAAAATCATGGCCAAATCTTCCCATTCATCACGCAAACATCTACGAGTCTAATCCA
CAACAACTTACAGCGGAATACAAGAAGGGTAATCTTACGGAATGGTTCTTTATATCTGAGAGGACAAAGATTAAAACAAA
CGGCCAGAAACAAAAACGTGTTGATCACAATGGAGGATACTGGCATTCAAAAGCAGTTACCAAGAAGATTAAAGTTAAAA
AAGATGTAGTTGGCTACAAAACCACACTAAATTATTTCGTTGGCAAACAACCAAACGGAGAAAGAACAAACTGGTTAATG
CAAGAATACTGGCTTGAGTCTTCCGGCCATAACAATACGGTGGATTATGCTTTGTGTAAGATTTATCTGAGTCCAACGGC
ACAAAAGAACATGAAAGAAGAAGACGTTGAAGAAGTAGAAGAGGAGGCTGTGCAGCCACGTACTGTTGAGATTCAGCAAC
CGCAACCACCGCAGTTTTATCCAACCCCGTTGGTTTCACACCAACCGCAGCCGCTGCCGCAGTTTTGGCCTACCGAACTG
GATTCATATCAACCGCAACGTCAAGATAATGAGTATCAAGAACCGCTCCAAGCACAGCCTCTTAATACTATCTATCAACA
TCAATCGCAATGTCCTAATAATGAGTCTGAGTATCAAGAACCGCACCAACCACAGCCTCTTAATACTATCTATCAACATC
AATCGCAACGTCATAATACCGAGTCTCAGTATCAAGAACCGCACCAACCACAGCCTCTTGATACTATAGATCATCATCAA
CCACAATGTCATGATAGTGCCTATCAAAATCCGCCCCAACCACAGCCTCTTGATACTATCCATTATCATCAATCACAACT
TCATGATATTGAGTATCAAGAACCGCACCAGTCACAGCCTTTTGATGATATTATTCATCATCAATCGCATCAGGTGCAGT
TTTGGCAAGCAACATCTGGGTCACATCAAAGGCAGCTTCAGGATCAGCTCCCACAGTCTTGGGCAGCCCCTTTGGATTCA
TACCCACCGCATTGTCACAATATTCAGTACCCACAACCGCAGCCTCTTGATGCTATTGAGTATCAATACCTATATCAATC
AGGTCCATTAACAACGTATAAAAACGTGATTGAGTCTTGTACTCAAGACAAGTCATATGGTGATATCAAAAAGGTGGATC
ATGCTCTCAAGATTCATTTGACGCCACGGGGAATAAAGAGAGAAGTAGAGGAAGAAGAGGATGAGAAGAGGAAGAGGAAG
AAGAAAGAAGGAGCCGTTGAAGCACCAAAAGAAGAGCTTGAGCAGCTGATCAACTCTCATCAGAACTCAAGCGATAATGA
TTCTTTTTTCACTGGCTTCGTTGATACACACCTACTACATATAGACATAGAGTCGTCCATCAGTAACTGTTGTTTGAAGA
AATCTCCAGACGAGAATTGA