Details for Chinese cabbage Locus Brara.D00338

Position : A04 ( 5`- 2414276 .. 2416235 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.D00338

Protein [Map View]
MVLKMSELAKPYFAMVCLQFGYAGMNLVTKVVLNGGMNHFVLVAYRNAFATAAIAPFALLSERKVRPKMTFPIFMQIFLL
AVLGPVIDQNMYYAGLRLTSPTFAGAVTSIVPALTFIISIIFRMEKVELRKVRFQAKVVGTLVIVVGAMLMILFKSPLIN
FLRSHLIREASSSAGEDYLRATVFLLIASFSWASFFVLQAATLKRYSSHLSLSTMVCFMGTLQSTALAFVMEPNLSAWNI
AFDMNLLASAYAGIMSSSIAYYVQGMMTKQKSVVFVTAFNPLIVIIVSIINFLILGQRLYLGGILGMMILMVGVCAVLWG
KEGDEEEEENIEEKFVDVIKCCKDCGNNSLSMPRIDEEVDVEMQSTKKDKTVVDLL*

DNA
ATGGTGTTAAAGATGTCGGAATTAGCTAAGCCCTACTTTGCAATGGTATGCCTCCAATTCGGATACGCTGGCATGAACCT
CGTTACCAAGGTTGTGCTCAACGGCGGCATGAACCATTTCGTCCTTGTGGCTTATCGTAATGCCTTTGCCACGGCCGCTA
TAGCGCCTTTTGCTCTTCTCTCGGAGAGGAAAGTGAGGCCAAAGATGACGTTCCCGATATTCATGCAAATATTTCTACTA
GCGGTTCTTGGGCCTGTGATCGATCAGAACATGTATTACGCTGGACTTAGACTCACCTCACCGACTTTTGCCGGCGCCGT
TACCAGCATCGTGCCCGCTTTGACATTTATCATTTCCATAATTTTCAGGATGGAGAAGGTGGAGCTGAGAAAAGTAAGAT
TCCAAGCAAAAGTGGTGGGGACATTAGTGATAGTGGTTGGAGCCATGTTGATGATTTTATTCAAAAGTCCTCTAATCAAC
TTTCTCCGGTCTCACCTCATCCGCGAAGCTTCGTCGTCCGCCGGCGAAGACTACCTCAGGGCCACCGTCTTCCTCCTCAT
CGCTTCGTTTTCTTGGGCTTCCTTCTTCGTTCTTCAGGCAGCTACGTTGAAGAGATACTCATCTCATCTTTCATTATCGA
CGATGGTTTGCTTCATGGGAACCTTACAATCCACAGCCCTAGCGTTTGTGATGGAACCAAACCTTTCTGCATGGAACATT
GCCTTCGACATGAACCTTCTAGCTTCTGCTTATGCGGGTATAATGTCGTCGAGCATAGCGTACTACGTGCAAGGGATGAT
GACGAAGCAAAAGAGCGTTGTCTTTGTCACTGCCTTTAACCCTCTTATTGTCATAATTGTATCCATAATTAACTTCCTTA
TCCTCGGCCAGAGATTATACCTTGGCGGGATTCTTGGAATGATGATACTAATGGTGGGAGTCTGTGCGGTTCTGTGGGGA
AAGGAAGGTGATGAAGAAGAAGAAGAGAATATTGAGGAGAAATTTGTAGACGTTATAAAATGTTGTAAAGATTGCGGAAA
CAATAGTCTCTCGATGCCAAGAATTGATGAGGAAGTAGATGTTGAAATGCAATCTACCAAGAAAGATAAGACGGTGGTGG
ATTTGTTGTAG