Details for Chinese cabbage Locus Brara.D00337

Position : A04 ( 5`- 2391751 .. 2393389 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.D00337

Protein [Map View]
MATASLVPTSNIFHVSPSVRTRASVIVASSHQQQPRRRDLLLKTAVAIPAILNLKEAPISEAREVEVGSFLPPSESDPSF
VLFKAKPSDTPALRAGNVQPYQFVLPPNWKQLRIANILSGNYCQPKCAEPWIEVKFENEKQGKVQVVASPLIRLTNKPNA
TIEDLGEPERVIASLGPFVTGNSYDSDELVDTSIEKIGDQTYYKYVLETPFALTGSHNLAKATAKGNTVVLFVVSATEKQ
WQSSQKTLQAILDSFQL*

DNA
ATGGCGACCGCGTCTCTCGTCCCGACATCAAACATCTTCCATGTCTCTCCGTCAGTTAGAACAAGAGCTAGCGTCATTGT
TGCATCATCTCATCAACAACAACCAAGAAGGAGAGACTTACTGCTGAAAACAGCGGTGGCTATTCCTGCGATTTTGAACT
TGAAGGAAGCTCCTATCTCTGAGGCGCGTGAGGTGGAAGTGGGATCGTTCTTACCACCTTCTGAGTCTGACCCTTCCTTC
GTCCTCTTCAAAGCCAAACCTTCTGATACTCCTGCTCTCCGCGCAGGGAACGTGCAGCCGTATCAGTTTGTTCTACCACC
GAACTGGAAACAGCTTCGAATAGCCAACATCTTGTCAGGCAACTACTGCCAACCGAAATGCGCAGAGCCATGGATAGAAG
TGAAGTTCGAGAACGAGAAGCAAGGGAAAGTTCAAGTAGTTGCTTCTCCTTTGATTCGTTTAACCAACAAGCCAAACGCA
ACTATTGAAGATCTCGGTGAGCCTGAGAGAGTGATTGCTTCTCTCGGTCCCTTTGTCACTGGAAACTCTTATGATTCTGA
TGAGCTTGTGGATACATCAATCGAAAAGATCGGTGATCAAACGTACTATAAGTATGTGTTGGAGACGCCGTTTGCGCTAA
CGGGAAGTCATAACCTTGCAAAAGCGACAGCGAAAGGGAACACTGTGGTTCTGTTTGTGGTGAGTGCTACTGAGAAGCAA
TGGCAGAGCTCACAGAAGACTCTTCAAGCCATTCTTGATTCTTTTCAACTGTAA