Details for Chinese cabbage Locus Brara.D00335

Position : A04 ( 5`- 2380682 .. 2382626 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.D00335

Protein [Map View]
MDSAFTTAAVVTGENGFTVDPFLVEALQNPRHRLTILRMELDVQRFLQSQEQQQFEFQRFPTSYLRLAAHRVASHYGLAT
SVQDGGVDGSENIILVTKTAVSKFPTVKLSDIPAAKQSESGKFEHMKVSIKTRPSKGSGFEGGEAEKKRGPLRSVEERKE
DYDRARARIFNGLTCFSGDESETQVYERSPSLGKDDSPAPTKNLTLRETGPTSRVAILRDSEKDRFDPDYDRNYKRYIRS
LPVNQNSHPPPFNMMQPPYYQMGFTGYNHIPNSHASLNFGLPGNAIMSPYGTTVVHPGDAMYMQVPMMYAHSYEQLRNAS
LQAQFCQQPLSFEYMQNR*

DNA
ATGGACTCTGCTTTCACAACCGCCGCTGTGGTTACGGGAGAGAATGGGTTTACGGTGGATCCTTTTCTCGTCGAGGCTTT
GCAGAACCCTCGCCATCGCCTGACGATTTTGCGGATGGAGCTTGACGTTCAACGGTTCTTACAGAGCCAAGAGCAGCAGC
AGTTCGAGTTCCAGCGTTTTCCTACTTCCTATCTCCGCCTTGCAGCTCACCGTGTTGCTAGCCACTACGGACTAGCTACA
TCTGTTCAAGACGGCGGCGTTGATGGGAGCGAGAACATAATCCTCGTGACTAAAACAGCGGTGAGCAAGTTTCCTACTGT
TAAGTTGTCTGATATCCCCGCGGCTAAACAATCAGAGAGTGGTAAGTTTGAGCACATGAAAGTCTCCATCAAGACTCGAC
CTTCCAAAGGATCTGGATTCGAGGGTGGTGAAGCTGAGAAGAAACGTGGTCCTCTTAGGAGTGTGGAAGAGAGGAAAGAA
GACTATGACAGAGCGCGAGCGCGCATATTCAACGGTCTCACTTGCTTCAGTGGTGATGAGTCTGAAACTCAGGTTTATGA
GAGGAGTCCAAGTCTTGGCAAAGATGACAGTCCAGCACCTACTAAGAACTTAACCCTCAGGGAAACTGGTCCAACCTCTC
GTGTTGCGATTCTTAGAGACAGTGAGAAAGATCGGTTTGATCCTGACTATGACCGCAATTACAAAAGGTACATAAGGAGC
CTTCCGGTTAATCAGAATTCTCATCCACCACCCTTCAACATGATGCAGCCACCGTACTACCAAATGGGATTTACCGGATA
CAACCATATCCCAAATAGTCATGCTTCTCTCAACTTTGGACTACCTGGGAACGCTATCATGAGTCCTTATGGCACCACTG
TTGTACATCCAGGGGATGCAATGTATATGCAAGTGCCTATGATGTATGCTCATTCGTATGAGCAGCTCAGAAATGCTTCT
CTTCAGGCACAGTTCTGTCAGCAACCCTTGAGCTTCGAGTACATGCAGAACCGCTAG